BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1475 (822 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g01710.1 68417.m00222 actin polymerization factor protein-rel... 40 0.003 At5g47500.1 68418.m05865 pectinesterase family protein contains ... 29 3.7 >At4g01710.1 68417.m00222 actin polymerization factor protein-related similar to human ARP2/3 complex 16 kd subunit, GenBank accession number O15511 likely functions to control the polymerization of actin Length = 132 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/82 (28%), Positives = 40/82 (48%) Frame = +2 Query: 263 LNNAPLGSSNQQVKENALTLTLKVLLAIKSAQIEEAVGSLSLDDIDNLMKYIYKGFEFPS 442 L +P + +++ K + + L+AIK I+ + +L ++ D LMKY+Y+G Sbjct: 41 LEGSPPKTRDERCKSANWIVVHRALMAIKD--IDGMLNALDVEYYDILMKYLYRGLSTGD 98 Query: 443 EGSSGHLLLWHDKAYSVGGLGC 508 + L H+K GLGC Sbjct: 99 RPTCDQCLKIHEKLTERAGLGC 120 >At5g47500.1 68418.m05865 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 362 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +2 Query: 434 FPSEGSSGHLLLWHDKAYSVGGLGC*QEFFQTE*ECNYYKYYTAQPINET 583 F G + WHD+A +G G +QT Y Y+TA+ I+ T Sbjct: 113 FKGAGRDVTAIEWHDRASDLGANGQQLRTYQTASVTVYANYFTARNISFT 162 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,729,433 Number of Sequences: 28952 Number of extensions: 295060 Number of successful extensions: 562 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 546 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 562 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1882599200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -