BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1474 (784 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 25 0.90 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 2.8 DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 23 3.6 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 4.8 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 22 4.8 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 22 4.8 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 22 4.8 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 22 4.8 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 22 4.8 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 4.8 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 22 4.8 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 4.8 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 22 4.8 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 24.6 bits (51), Expect = 0.90 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -2 Query: 711 GLWSRDTGRVAPLLDTSPPVDNREQE 634 G W R+TG APL SP D++ Q+ Sbjct: 283 GKWERETGHNAPLY--SPSSDSQYQK 306 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.0 bits (47), Expect = 2.8 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -2 Query: 711 GLWSRDTGRVAPL 673 G W + TG VAPL Sbjct: 1594 GQWDKQTGHVAPL 1606 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -2 Query: 711 GLWSRDTGRVAPL 673 G W + TG VAPL Sbjct: 2517 GHWDKQTGHVAPL 2529 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 22.6 bits (46), Expect = 3.6 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 Query: 693 TGRVAPLLDTSPPVDNREQETR*GGSQAPPLT 598 TG APL S VD+ Q GG+ A +T Sbjct: 212 TGLNAPLYGNSMSVDSSVQSWLSGGASASKVT 243 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 4.8 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = +2 Query: 587 SPRAVSGGA*DPPHRVSCSRLSTGGDVSRSGATRPVSLDHRPP 715 SP+ +S P S S SG T P+S+ PP Sbjct: 112 SPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPP 154 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 4.8 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = +2 Query: 587 SPRAVSGGA*DPPHRVSCSRLSTGGDVSRSGATRPVSLDHRPP 715 SP+ +S P S S SG T P+S+ PP Sbjct: 112 SPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPP 154 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.2 bits (45), Expect = 4.8 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = +2 Query: 587 SPRAVSGGA*DPPHRVSCSRLSTGGDVSRSGATRPVSLDHRPP 715 SP+ +S P S S SG T P+S+ PP Sbjct: 112 SPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPP 154 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 4.8 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = +2 Query: 587 SPRAVSGGA*DPPHRVSCSRLSTGGDVSRSGATRPVSLDHRPP 715 SP+ +S P S S SG T P+S+ PP Sbjct: 112 SPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPP 154 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.2 bits (45), Expect = 4.8 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = +2 Query: 587 SPRAVSGGA*DPPHRVSCSRLSTGGDVSRSGATRPVSLDHRPP 715 SP+ +S P S S SG T P+S+ PP Sbjct: 112 SPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPP 154 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.2 bits (45), Expect = 4.8 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = +2 Query: 587 SPRAVSGGA*DPPHRVSCSRLSTGGDVSRSGATRPVSLDHRPP 715 SP+ +S P S S SG T P+S+ PP Sbjct: 68 SPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPP 110 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 22.2 bits (45), Expect = 4.8 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = +2 Query: 587 SPRAVSGGA*DPPHRVSCSRLSTGGDVSRSGATRPVSLDHRPP 715 SP+ +S P S S SG T P+S+ PP Sbjct: 112 SPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPP 154 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 22.2 bits (45), Expect = 4.8 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = +2 Query: 587 SPRAVSGGA*DPPHRVSCSRLSTGGDVSRSGATRPVSLDHRPP 715 SP+ +S P S S SG T P+S+ PP Sbjct: 112 SPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPP 154 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 22.2 bits (45), Expect = 4.8 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = +3 Query: 297 PEST*LPYNKETHLHTQPGSDPATLVAGKQSSNRSSFCEPLVIPS 431 P+S P + PAT +G +S S+ PL IP+ Sbjct: 15 PQSAATPISSSGMTSPAAAPPPATTSSGSPASVASNASAPLHIPA 59 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.2 bits (45), Expect = 4.8 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = +2 Query: 587 SPRAVSGGA*DPPHRVSCSRLSTGGDVSRSGATRPVSLDHRPP 715 SP+ +S P S S SG T P+S+ PP Sbjct: 112 SPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPP 154 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,312 Number of Sequences: 336 Number of extensions: 4807 Number of successful extensions: 20 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21168876 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -