BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1474 (784 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U80846-3|AAC70890.1| 2232|Caenorhabditis elegans Hypothetical pr... 28 6.6 U40948-3|AAA81729.1| 307|Caenorhabditis elegans Hypothetical pr... 28 8.7 >U80846-3|AAC70890.1| 2232|Caenorhabditis elegans Hypothetical protein K06A9.1b protein. Length = 2232 Score = 28.3 bits (60), Expect = 6.6 Identities = 19/58 (32%), Positives = 29/58 (50%) Frame = -1 Query: 379 PATRVAGSEPGCVCRCVSLLYGSQVLSGSPSQSTSLPAASTQKVLRDLEGDSKVTSAP 206 P+T A S G VS + + + S S +++P+ STQ EG SK +S+P Sbjct: 1357 PSTTFASSTSGSTISDVSSVSTTSLAPLSSSLPSTVPS-STQSFSSTSEGSSKASSSP 1413 >U40948-3|AAA81729.1| 307|Caenorhabditis elegans Hypothetical protein F55D10.4 protein. Length = 307 Score = 27.9 bits (59), Expect = 8.7 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -3 Query: 362 WIRARLCMQVCFFVIR*SSTFWIAKPEHLASGSV 261 W+ L + FF+IR S +F +A P HLA SV Sbjct: 141 WLLVTLLLLSDFFLIRLSRSFVLAVPFHLALLSV 174 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,438,703 Number of Sequences: 27780 Number of extensions: 426828 Number of successful extensions: 863 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 821 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 863 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1893203640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -