BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1474 (784 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g63370.1 68414.m07164 flavin-containing monooxygenase family ... 30 2.0 At1g62600.1 68414.m07062 flavin-containing monooxygenase family ... 28 8.0 >At1g63370.1 68414.m07164 flavin-containing monooxygenase family protein / FMO family protein similar to FMO5 from Cavia porcellus [SP|P49109]; contains Pfam profile: PF00743 Flavin-binding monooxygenase-like Length = 450 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -3 Query: 215 LRTLTCTCNVPVI-RTYTTRQSGINFDLDKWLWTQCG 108 ++T T V I + YT R F+ D WL +QCG Sbjct: 367 IKTFYSTLEVQGIPKRYTHRMGNTQFEYDNWLASQCG 403 >At1g62600.1 68414.m07062 flavin-containing monooxygenase family protein / FMO family protein low similarity to flavin-containing monooxygenase 2 from Cavia porcellus [SP|P36366]; contains Pfam profile PF00743 Flavin-binding monooxygenase-like Length = 452 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = -3 Query: 215 LRTLTCTCNVPVIRTYTTRQSGIN-FDLDKWLWTQCG 108 ++TL T + I T Q GI+ F+ + WL +QCG Sbjct: 369 IKTLYSTLDAQGIAKRYTHQMGISQFEYNSWLASQCG 405 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,283,197 Number of Sequences: 28952 Number of extensions: 397744 Number of successful extensions: 805 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 772 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 805 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1755792000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -