BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1473 (732 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22A12.07c |ogm1|oma1|protein O-mannosyltransferase Ogm1|Schi... 26 6.4 SPAC9E9.04 |||bcap family homolog|Schizosaccharomyces pombe|chr ... 26 6.4 >SPAC22A12.07c |ogm1|oma1|protein O-mannosyltransferase Ogm1|Schizosaccharomyces pombe|chr 1|||Manual Length = 893 Score = 25.8 bits (54), Expect = 6.4 Identities = 11/33 (33%), Positives = 24/33 (72%) Frame = -1 Query: 483 VRIWFIHDVFV*NFYSKLSMQCYFIVWQIFILS 385 ++++F+ + FV +YS +S+ +F++ QIF L+ Sbjct: 564 LQVFFMGNPFV--WYSVISLVAFFVIVQIFCLA 594 >SPAC9E9.04 |||bcap family homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 188 Score = 25.8 bits (54), Expect = 6.4 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = -3 Query: 415 FYCLANIYIISYMLFSILDVSRVYVSKSANPYKRYDPLILKTVIEA 278 FY N+Y+ LF L V+R Y++ A + L+T +EA Sbjct: 98 FYAQRNLYLCGSALFLSLVVNRYYLALEAMIAAQDKMQALQTQVEA 143 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,969,847 Number of Sequences: 5004 Number of extensions: 62081 Number of successful extensions: 131 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 131 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 345237368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -