BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1473 (732 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18371| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_40223| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_1686| Best HMM Match : 7tm_1 (HMM E-Value=5.3e-12) 28 9.0 >SB_18371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 264 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 207 TCNKNDETSRWTK 169 TCN NDE SRWTK Sbjct: 127 TCNDNDEVSRWTK 139 >SB_40223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 28.3 bits (60), Expect = 6.8 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = -3 Query: 451 LELLFKIINAVLFYCLANIYIISYMLFSILDVSRVYVSK 335 L K+ NA++ +A + ++Y LFS+L + +Y+ K Sbjct: 375 LSTKLKVYNAIVLPGIAISFYVNYYLFSVLLLVYIYIRK 413 >SB_1686| Best HMM Match : 7tm_1 (HMM E-Value=5.3e-12) Length = 362 Score = 27.9 bits (59), Expect = 9.0 Identities = 13/40 (32%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = -3 Query: 520 CLCSITIFFKFVGKNLVYS*CFCLEL-LFKIINAVLFYCL 404 C+ +I I +F+GK+ + + FCL + + +++ VLF C+ Sbjct: 161 CVAAI-ISLRFIGKSYLRNIIFCLHIDIAIVVSVVLFACV 199 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,760,226 Number of Sequences: 59808 Number of extensions: 401435 Number of successful extensions: 746 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 704 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 746 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -