BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1472 (771 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q3YS16 Cluster: Sodium:dicarboxylate symporter; n=10; R... 33 7.9 UniRef50_A2BRT4 Cluster: Possible exodeoxyribonuclease V subunit... 33 7.9 >UniRef50_Q3YS16 Cluster: Sodium:dicarboxylate symporter; n=10; Rickettsiales|Rep: Sodium:dicarboxylate symporter - Ehrlichia canis (strain Jake) Length = 426 Score = 33.1 bits (72), Expect = 7.9 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -3 Query: 427 HNFSKIFLINKILRCVIETFLMDG 356 HNF K+FL N ++ CVI FL+ G Sbjct: 145 HNFIKVFLDNNVIGCVILAFLIGG 168 >UniRef50_A2BRT4 Cluster: Possible exodeoxyribonuclease V subunit C 125 kD polypeptide; n=6; cellular organisms|Rep: Possible exodeoxyribonuclease V subunit C 125 kD polypeptide - Prochlorococcus marinus (strain AS9601) Length = 1060 Score = 33.1 bits (72), Expect = 7.9 Identities = 18/48 (37%), Positives = 27/48 (56%) Frame = -2 Query: 206 EKLKIKP*KAFYSVRDLRNLRKICSIDFKFCNKYLSRNDNNLKF*YFN 63 EK+ KP Y + ++NLRKI +I F+ N+ +DNNL + N Sbjct: 182 EKIPEKP-SCLYMIEVIKNLRKIKNIQFQVPNQIYIFSDNNLSKLHIN 228 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 713,657,874 Number of Sequences: 1657284 Number of extensions: 13935417 Number of successful extensions: 23541 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22794 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23540 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 64615845515 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -