BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1472 (771 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_55307| Best HMM Match : HEAT (HMM E-Value=2.4e-11) 28 7.3 >SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2102 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +1 Query: 82 KLLSFLDKYLLQNLKSMEQIFLRFRKSR 165 K LS LD ++QN++ E++ LR KSR Sbjct: 748 KFLSRLDSQIMQNVEKSEKLILRDNKSR 775 >SB_55307| Best HMM Match : HEAT (HMM E-Value=2.4e-11) Length = 1552 Score = 28.3 bits (60), Expect = 7.3 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = +3 Query: 390 RILLIKNIFEKLCYLRSQCLNM*GIGCRL*IYIVINIHTILSRVKWILVYILP 548 RIL+ + + Y QC C + IY++I+IH + + K ++VY LP Sbjct: 728 RILVGQVALRESVYRNPQCFMGIKQSCSIFIYVLISIH-MTFKYKDLVVYTLP 779 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,114,569 Number of Sequences: 59808 Number of extensions: 438720 Number of successful extensions: 691 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 632 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 691 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2095976575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -