BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1468 (732 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0435 - 24259864-24260206,24260302-24260467,24261175-242612... 28 8.8 >03_05_0435 - 24259864-24260206,24260302-24260467,24261175-24261241, 24261553-24261648,24261718-24261898,24262252-24262323, 24262393-24262505,24262596-24262817,24263262-24263910, 24264118-24264206,24265932-24266015,24266219-24266358, 24266522-24266573 Length = 757 Score = 27.9 bits (59), Expect = 8.8 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -3 Query: 433 HDFDSNLDQSCTYFSQ-PNTL*THLKAIHSF*LFYDKIR 320 H F +L+ Y + P+ + HL+ +H LF DK+R Sbjct: 320 HHFSDSLEVPSDYMAMNPSAVSQHLRGLHRRSLFNDKVR 358 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,003,659 Number of Sequences: 37544 Number of extensions: 256520 Number of successful extensions: 373 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 368 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 373 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1921741964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -