BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1468 (732 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016429-1|AAB65365.2| 518|Caenorhabditis elegans Hypothetical ... 31 1.1 Z74473-2|CAA98949.2| 319|Caenorhabditis elegans Hypothetical pr... 29 3.4 >AF016429-1|AAB65365.2| 518|Caenorhabditis elegans Hypothetical protein T21H3.4 protein. Length = 518 Score = 30.7 bits (66), Expect = 1.1 Identities = 20/73 (27%), Positives = 34/73 (46%) Frame = +1 Query: 211 IK*KF*GLHKLIMMLAVYECV*KNVFPNIGLFENVRFEFYHKIIKMNVLLLNVFTMYSVE 390 +K K ++++ LA++ V KN PN G F V++ + M +LN Y Sbjct: 213 VKKKATKINQMKKSLALHAMV-KNELPNSGNFFFVKYPHRDSLCYMRFSILNYSKEYGSR 271 Query: 391 KNTYNFDLNLSRN 429 N N D+++ N Sbjct: 272 SNKTNTDISMHHN 284 >Z74473-2|CAA98949.2| 319|Caenorhabditis elegans Hypothetical protein F56H9.1 protein. Length = 319 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -3 Query: 724 AYFCLLTSLVINILILTTIYFLHKSNKEILY 632 +++ L TS ++ IL T+YFL+ E+LY Sbjct: 40 SFYILCTSKTLSNFILLTVYFLYIGPTELLY 70 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,299,653 Number of Sequences: 27780 Number of extensions: 279142 Number of successful extensions: 618 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 600 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 618 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1714401074 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -