BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1466 (734 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 24 4.2 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 24 4.2 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 24 5.6 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 24 5.6 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 7.4 U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. 23 9.8 DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription fact... 23 9.8 DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription fact... 23 9.8 DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription fact... 23 9.8 DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reduct... 23 9.8 AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. 23 9.8 AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase p... 23 9.8 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 24.2 bits (50), Expect = 4.2 Identities = 20/72 (27%), Positives = 31/72 (43%) Frame = +1 Query: 247 NSELVQWCTVFHQILDDFYYCIEFVW*IWACEPLLFYTGFLLFLQSISDMASINSFVLLS 426 + E + C VF Q LD C+ + + C F G+L+ L S +F+ + Sbjct: 473 SDETNERCPVFLQWLD----CVHQIHRQFPCS-FEFDMGYLIKLAQHSHSCLFGTFLCNT 527 Query: 427 NKSRHRISFPDK 462 K R S PD+ Sbjct: 528 VKERQENSVPDR 539 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 24.2 bits (50), Expect = 4.2 Identities = 20/72 (27%), Positives = 31/72 (43%) Frame = +1 Query: 247 NSELVQWCTVFHQILDDFYYCIEFVW*IWACEPLLFYTGFLLFLQSISDMASINSFVLLS 426 + E + C VF Q LD C+ + + C F G+L+ L S +F+ + Sbjct: 473 SDETNERCPVFLQWLD----CVHQIHRQFPCS-FEFDMGYLIKLAQHSHSCLFGTFLCNT 527 Query: 427 NKSRHRISFPDK 462 K R S PD+ Sbjct: 528 VKERQENSVPDR 539 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 23.8 bits (49), Expect = 5.6 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 449 HFLINCYFLYNYSQRLETGM 508 H++I CY++Y R+ET M Sbjct: 101 HYVIRCYYVYT---RMETDM 117 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 570 DNTAHPIKQKHVEIVSWLPC 511 +N HPIK+ V I+S L C Sbjct: 116 NNVHHPIKKMAVSILSALAC 135 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.4 bits (48), Expect = 7.4 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -1 Query: 506 CRSQVFESSCTKSNSLSGNEIL 441 CR VF+ SC SN S N+IL Sbjct: 745 CRV-VFDGSCKTSNGRSLNDIL 765 >U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. Length = 278 Score = 23.0 bits (47), Expect = 9.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +3 Query: 570 HWITCQIASINGPDGTL 620 HW++ Q +NG DG++ Sbjct: 164 HWLSEQCNRLNGTDGSI 180 >DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 103 YVYLNRHACLLNTTSSKDSYHEI 125 >DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 103 YVYLNRHACLLNTTSSKDSYHEI 125 >DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 71 YCLIFRHRCLLGT**SYNFYEEI 139 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reductase protein. Length = 487 Score = 23.0 bits (47), Expect = 9.8 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 200 ISLCQRNNQKILENVGIPNWYNGVPFF 280 +++ N Q +L WYNG+P F Sbjct: 134 LNIPNENLQNVLSAREFVAWYNGLPGF 160 >AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. Length = 438 Score = 23.0 bits (47), Expect = 9.8 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +2 Query: 203 SLCQRNNQKILENVGIPNWYNGVPFFTRYWMTFTI 307 S+C R ++ I E P + V + +W+ F I Sbjct: 39 SMCNREHKWIPEATKAPEMMHTVDHESSFWLIFII 73 >AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 23.0 bits (47), Expect = 9.8 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +3 Query: 168 DIYDIVLCNNKSVCANEIIRKSWKMSEFRIGT 263 D +D+ L NK+ ++ W+ S+F +GT Sbjct: 435 DSFDVQL--NKANAPKNVLLTFWQRSQFDLGT 464 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 791,941 Number of Sequences: 2352 Number of extensions: 16643 Number of successful extensions: 122 Number of sequences better than 10.0: 53 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75260343 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -