BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1466 (734 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 22 5.2 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 22 5.2 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 22 5.2 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 22 5.2 AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 22 5.2 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 22 6.9 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 21 9.1 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 22.2 bits (45), Expect = 5.2 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 Query: 271 YTIVPIRNSDIFQDFLIISLAQTDL 197 +T P+R I Q+F I+SLA DL Sbjct: 62 FTYRPLR---IVQNFFIVSLAVADL 83 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 22.2 bits (45), Expect = 5.2 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 Query: 271 YTIVPIRNSDIFQDFLIISLAQTDL 197 +T P+R I Q+F I+SLA DL Sbjct: 62 FTYRPLR---IVQNFFIVSLAVADL 83 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 22.2 bits (45), Expect = 5.2 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 221 NQKILENVGIPNWYNGVP 274 N K+ + IP W NGVP Sbjct: 60 NDKVF--ITIPRWKNGVP 75 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 22.2 bits (45), Expect = 5.2 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 Query: 271 YTIVPIRNSDIFQDFLIISLAQTDL 197 +T P+R I Q+F I+SLA DL Sbjct: 62 FTYRPLR---IVQNFFIVSLAVADL 83 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 139 KKINENSEKPIFMTLYCVIINQFVPTK*SENL 234 K N + P+F T++ + I + +P + ENL Sbjct: 312 KAKNMENRFPLFTTVHRICIGETMPMELIENL 343 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 21.8 bits (44), Expect = 6.9 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +2 Query: 242 VGIPNWYNGVPFFTRY 289 V +P W NG+P Y Sbjct: 81 VTVPRWRNGIPATLTY 96 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.4 bits (43), Expect = 9.1 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +2 Query: 5 NPFNFSDLNF 34 N FNF+D+NF Sbjct: 394 NDFNFNDVNF 403 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 217,557 Number of Sequences: 438 Number of extensions: 5378 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -