Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= br--1465
         (690 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY695258-1|AAW21975.1|  232|Tribolium castaneum muscle segment h...    24   1.0  
U09586-1|AAC47270.1|  425|Tribolium castaneum ORF 1 protein.           21   9.5  

>AY695258-1|AAW21975.1|  232|Tribolium castaneum muscle segment
           homeodomain protein protein.
          Length = 232

 Score = 24.2 bits (50), Expect = 1.0
 Identities = 16/49 (32%), Positives = 23/49 (46%)
 Frame = +1

Query: 223 RHMPRDPSRNPFTTREDLITLIVITTIQPKIIHAERITITLELRLPRTQ 369
           +H P    R PFTT++ L+ L      +  +  AER   +  LRL   Q
Sbjct: 111 KHKPNRKPRTPFTTQQ-LLALEKKFRDKQYLSIAERAEFSSSLRLTEPQ 158


>U09586-1|AAC47270.1|  425|Tribolium castaneum ORF 1 protein.
          Length = 425

 Score = 21.0 bits (42), Expect = 9.5
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -3

Query: 580 WFIRW*SWNQP 548
           WF+RW +  QP
Sbjct: 20  WFVRWLNSQQP 30


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 156,248
Number of Sequences: 336
Number of extensions: 3414
Number of successful extensions: 5
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18114270
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)