BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1465 (690 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 24 1.0 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 21 9.5 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 24.2 bits (50), Expect = 1.0 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = +1 Query: 223 RHMPRDPSRNPFTTREDLITLIVITTIQPKIIHAERITITLELRLPRTQ 369 +H P R PFTT++ L+ L + + AER + LRL Q Sbjct: 111 KHKPNRKPRTPFTTQQ-LLALEKKFRDKQYLSIAERAEFSSSLRLTEPQ 158 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 21.0 bits (42), Expect = 9.5 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = -3 Query: 580 WFIRW*SWNQP 548 WF+RW + QP Sbjct: 20 WFVRWLNSQQP 30 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,248 Number of Sequences: 336 Number of extensions: 3414 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -