BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1464 (796 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC736.04c |gma12||alpha-1,2-galactosyltransferase Gma12 |Schiz... 26 7.1 SPBC725.11c |php2||CCAAT-binding factor complex subunit Php2 |Sc... 26 7.1 SPAC22E12.09c |krp1|krp|kexin|Schizosaccharomyces pombe|chr 1|||... 25 9.4 >SPCC736.04c |gma12||alpha-1,2-galactosyltransferase Gma12 |Schizosaccharomyces pombe|chr 3|||Manual Length = 375 Score = 25.8 bits (54), Expect = 7.1 Identities = 12/48 (25%), Positives = 23/48 (47%) Frame = +3 Query: 375 TAPDTPINRSIPATQDQTIRSILGKITLSRTTLDQIILSDHTIQRNYH 518 T+ TP+ S+ +TQ T+R + ++ TL + + T+ H Sbjct: 43 TSTWTPVVSSVTSTQTDTLRVTISEVVSVTATLTETFTATPTVTSVVH 90 >SPBC725.11c |php2||CCAAT-binding factor complex subunit Php2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 334 Score = 25.8 bits (54), Expect = 7.1 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 183 RRPYIHHNRHHGVPNMPRDP 242 ++PY+H +RH PR P Sbjct: 41 KKPYLHESRHKHAMRRPRGP 60 >SPAC22E12.09c |krp1|krp|kexin|Schizosaccharomyces pombe|chr 1|||Manual Length = 709 Score = 25.4 bits (53), Expect = 9.4 Identities = 8/36 (22%), Positives = 23/36 (63%) Frame = +3 Query: 372 LTAPDTPINRSIPATQDQTIRSILGKITLSRTTLDQ 479 L AP+ +N+S + ++TI ++ + T+++ +++ Sbjct: 455 LIAPEINVNKSFGSVNNETITEMVSEFTVTKDMIEK 490 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,155,587 Number of Sequences: 5004 Number of extensions: 63479 Number of successful extensions: 131 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 131 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 131 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 387388442 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -