BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1461 (760 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25557| Best HMM Match : HECT (HMM E-Value=0) 61 8e-10 SB_57295| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_25423| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_12797| Best HMM Match : HECT (HMM E-Value=0) 41 0.001 SB_55025| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_5238| Best HMM Match : HECT (HMM E-Value=0) 38 0.009 SB_35146| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_44630| Best HMM Match : HECT (HMM E-Value=0) 36 0.036 SB_53819| Best HMM Match : HECT (HMM E-Value=4e-07) 36 0.047 SB_47662| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.047 SB_51591| Best HMM Match : HECT (HMM E-Value=0) 35 0.062 SB_20163| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.062 SB_55819| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.082 SB_19076| Best HMM Match : HECT (HMM E-Value=0) 34 0.14 SB_19247| Best HMM Match : HECT (HMM E-Value=5.3) 32 0.44 SB_46466| Best HMM Match : Neur_chan_memb (HMM E-Value=4.8) 32 0.44 SB_8401| Best HMM Match : ig (HMM E-Value=8.1e-22) 31 1.3 SB_13743| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_8500| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_41346| Best HMM Match : Ion_trans (HMM E-Value=0) 29 5.4 SB_9642| Best HMM Match : PSI (HMM E-Value=3.6) 29 5.4 SB_22229| Best HMM Match : Arm (HMM E-Value=0) 28 9.5 >SB_25557| Best HMM Match : HECT (HMM E-Value=0) Length = 454 Score = 61.3 bits (142), Expect = 8e-10 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = +1 Query: 256 LDPDEYLPSVMTCVNYLKLPDYSSAEVMRAKLRLAASE 369 L D YLPSVMTCVNYLKLPDY+S E+M KLR AA E Sbjct: 290 LSADNYLPSVMTCVNYLKLPDYTSKEIMLDKLRTAAHE 327 Score = 32.7 bits (71), Expect = 0.33 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = +2 Query: 200 GFKALNPPLTVVRKSLE 250 GF++LNPPLT+VRK+ E Sbjct: 271 GFRSLNPPLTIVRKTFE 287 >SB_57295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1320 Score = 41.9 bits (94), Expect = 5e-04 Identities = 19/37 (51%), Positives = 25/37 (67%) Frame = +2 Query: 122 ILASYNREEQRHFLQFVTGSPRLPTGGFKALNPPLTV 232 I++S +EE LQFVTGS +LP GGF L+P L + Sbjct: 836 IVSSLTQEELARLLQFVTGSSQLPPGGFAELSPQLQI 872 >SB_25423| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 528 Score = 41.5 bits (93), Expect = 7e-04 Identities = 20/43 (46%), Positives = 27/43 (62%) Frame = +1 Query: 265 DEYLPSVMTCVNYLKLPDYSSAEVMRAKLRLAASEGQHSFHLS 393 ++ LPS TC+N LKLP+Y + E+MR +L A G F LS Sbjct: 487 EDRLPSASTCMNMLKLPEYPTDEMMRERLLYAVESGA-GFELS 528 >SB_12797| Best HMM Match : HECT (HMM E-Value=0) Length = 749 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/47 (40%), Positives = 27/47 (57%) Frame = +2 Query: 74 DHGYNAESRGIRMLIDILASYNREEQRHFLQFVTGSPRLPTGGFKAL 214 D G +S IR +I+ S++ E++R L F TGS R+P GG L Sbjct: 651 DGGLTKDSALIRWFWEIVHSFDMEQKRQLLMFTTGSDRIPVGGLAKL 697 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +1 Query: 274 LPSVMTCVNYLKLPDYSSAEVMRAKLRLAASEGQ 375 LP+ TC N L LPDY++ E + +L A + + Sbjct: 711 LPTAHTCFNVLLLPDYATKEKLEERLLKAITHAK 744 >SB_55025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2468 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/46 (41%), Positives = 27/46 (58%) Frame = +2 Query: 77 HGYNAESRGIRMLIDILASYNREEQRHFLQFVTGSPRLPTGGFKAL 214 H YN S I+ L S+++ + FLQFVTG+ ++P GF AL Sbjct: 2396 HQYNENSLQIQWFWRALRSFDQAARAKFLQFVTGTSKVPLQGFAAL 2441 >SB_5238| Best HMM Match : HECT (HMM E-Value=0) Length = 212 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = +2 Query: 83 YNAESRGIRMLIDILASYNREEQRHFLQFVTGSPRLPTGGFKAL 214 Y S+ + + +Y+ E++ LQFVTG+ RLP GGF L Sbjct: 111 YTRNSKQVMWFWQAVKAYDNEKRIRLLQFVTGTCRLPVGGFTEL 154 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +1 Query: 265 DEYLPSVMTCVNYLKLPDYSSAEVMRAKLRLAASE 369 + +LP TC N L LP Y S E + KL A E Sbjct: 171 ETWLPRSHTCFNRLDLPPYKSYEQLVEKLTFAIEE 205 >SB_35146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 36.7 bits (81), Expect = 0.020 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +1 Query: 262 PDEYLPSVMTCVNYLKLPDYSSAEVMRAKLRLA 360 PD YLP TC LK+P YSS ++ KL+ A Sbjct: 8 PDHYLPESYTCFFLLKMPRYSSHRILCEKLKYA 40 >SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3592 Score = 36.7 bits (81), Expect = 0.020 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +1 Query: 262 PDEYLPSVMTCVNYLKLPDYSSAEVMRAKLRLA 360 PD YLP TC LK+P YSS ++ KL+ A Sbjct: 3529 PDHYLPESYTCFFLLKMPRYSSHRILCEKLKYA 3561 >SB_44630| Best HMM Match : HECT (HMM E-Value=0) Length = 1003 Score = 35.9 bits (79), Expect = 0.036 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +2 Query: 74 DHGYNAESRGIRMLIDILASYNREEQRHFLQFVTGSPRLPTGGFKAL 214 D GY+A+ I+M ++ +++ L FVTGS R+P G L Sbjct: 905 DDGYSAQHSTIKMFWNVFNEMTNHQKKALLMFVTGSDRVPLKGLSNL 951 Score = 33.5 bits (73), Expect = 0.19 Identities = 16/40 (40%), Positives = 25/40 (62%) Frame = +1 Query: 274 LPSVMTCVNYLKLPDYSSAEVMRAKLRLAASEGQHSFHLS 393 LP+ MTC N L LP+Y+S + ++ +L + A E F L+ Sbjct: 965 LPTAMTCFNRLLLPEYTSPKRLKERL-IVAIENSKGFGLT 1003 >SB_53819| Best HMM Match : HECT (HMM E-Value=4e-07) Length = 279 Score = 35.5 bits (78), Expect = 0.047 Identities = 19/46 (41%), Positives = 27/46 (58%) Frame = +2 Query: 77 HGYNAESRGIRMLIDILASYNREEQRHFLQFVTGSPRLPTGGFKAL 214 H YN S I+ L S+++ + FLQFVTG+ ++P GF AL Sbjct: 156 HKYNENS--IQWFWRALRSFDQAARAKFLQFVTGTSKVPLQGFAAL 199 >SB_47662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 35.5 bits (78), Expect = 0.047 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +2 Query: 80 GYNAESRGIRMLIDILASYNREEQRHFLQFVTGSPRLPTGG 202 GY+ IR D + ++N + ++ L F TGS R+P GG Sbjct: 187 GYSKNDNTIRYFWDTVMNFNTDLKKKMLLFATGSDRIPIGG 227 >SB_51591| Best HMM Match : HECT (HMM E-Value=0) Length = 694 Score = 35.1 bits (77), Expect = 0.062 Identities = 18/37 (48%), Positives = 22/37 (59%) Frame = +2 Query: 104 IRMLIDILASYNREEQRHFLQFVTGSPRLPTGGFKAL 214 I L +AS EE+ L+F TGSP +P GGF AL Sbjct: 599 ITWLWKTIASLKEEEKALLLKFSTGSPCVPIGGFAAL 635 Score = 35.1 bits (77), Expect = 0.062 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +1 Query: 274 LPSVMTCVNYLKLPDYSSAEVMRAKLRLAASEGQHSF 384 +P TC N LKL +Y S + +R KL +A G F Sbjct: 655 IPEASTCFNLLKLTNYESEKQLREKLLIAIRHGSEGF 691 >SB_20163| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 400 Score = 35.1 bits (77), Expect = 0.062 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +2 Query: 131 SYNREEQRHFLQFVTGSPRLPTGGFKAL 214 +Y+ E++ LQFVTG+ RLP GGF L Sbjct: 62 AYDNEKRIRLLQFVTGTCRLPVGGFTEL 89 >SB_55819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2408 Score = 34.7 bits (76), Expect = 0.082 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 6/46 (13%) Frame = +1 Query: 241 IAGVLLDPDEY------LPSVMTCVNYLKLPDYSSAEVMRAKLRLA 360 + G+ L PD+ LP+ TC L+LP YSS E M +LR A Sbjct: 2094 LVGIPLTPDDIEEGVDSLPTAQTCFFQLRLPPYSSQEAMANRLRYA 2139 >SB_19076| Best HMM Match : HECT (HMM E-Value=0) Length = 2018 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +1 Query: 265 DEYLPSVMTCVNYLKLPDYSSAEVMRAKLRLA 360 D LP+ TC++ L +P YSS ++++KL LA Sbjct: 1978 DHQLPTANTCISRLYMPLYSSRAILKSKLLLA 2009 >SB_19247| Best HMM Match : HECT (HMM E-Value=5.3) Length = 158 Score = 32.3 bits (70), Expect = 0.44 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +1 Query: 274 LPSVMTCVNYLKLPDYSSAEVMRAKLRLAA 363 LP TC + L LP YSSA+V K+R A+ Sbjct: 114 LPEAATCSSTLFLPKYSSAKVAEEKIRYAS 143 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +2 Query: 98 RGIRMLIDILASYNREEQRHFLQFVTGSPRLP 193 R I+ L + L ++ E++ FL+FVTG RLP Sbjct: 38 RRIKDLWNALENFTNEDRSRFLRFVTGRRRLP 69 >SB_46466| Best HMM Match : Neur_chan_memb (HMM E-Value=4.8) Length = 498 Score = 32.3 bits (70), Expect = 0.44 Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 3/78 (3%) Frame = -2 Query: 225 SGGFNA-LNPPVGSLGLPVTNCKKCRCSSRLYEAKISISMRIPRDSALYP*SGRIHSASI 49 SGG + L PP S ++CK ++ ++ K ++ RI + P S HSAS+ Sbjct: 91 SGGSDVILYPPKSSATFTSSSCKPPESETQEFQEKNALEARISGEGT--PISMSNHSASL 148 Query: 48 RGSRRWSR--PPDGLPQN 1 S S PP G+P N Sbjct: 149 SSSTASSSSFPPCGVPSN 166 >SB_8401| Best HMM Match : ig (HMM E-Value=8.1e-22) Length = 965 Score = 30.7 bits (66), Expect = 1.3 Identities = 18/59 (30%), Positives = 29/59 (49%) Frame = +3 Query: 3 FAEVHQVVVTNDGIHVCWRNECVRIMDTMQNRGVYACLLIFWLRTTVKNNDTSYSLLLE 179 F + V+ T DGI V W N + TM+ R V A W+ ++ ++ S S +L+ Sbjct: 246 FPTIDDVIPTQDGITVTWLNPSSEVQCTMRAR-VLAGRSRDWVTSSGSSSSASLSCVLD 303 >SB_13743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +2 Query: 131 SYNREEQRHFLQFVTGSPRLPTGGFKAL 214 S++ E + LQFVTG+ R+P GF L Sbjct: 483 SFDIETRARLLQFVTGTSRVPMNGFSEL 510 >SB_8500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3408 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +1 Query: 283 VMTCVNYLKLPDYSSAEVMRAKLRLA 360 V TC+ +KLP YS+ E+M +KL A Sbjct: 3372 VETCMFMIKLPPYSTQEIMTSKLLYA 3397 >SB_41346| Best HMM Match : Ion_trans (HMM E-Value=0) Length = 1264 Score = 28.7 bits (61), Expect = 5.4 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = +1 Query: 490 VIVSSV*L-WTNVYVQSEPIFYNVMDTESAAFLVLFIFSILLDYIDM-FISYF 642 + SS+ L + +VY+ S+P V+ + F V+F +LL +I + F +YF Sbjct: 414 IAASSISLAFEDVYLDSKPTLKQVLQILNILFAVIFTVEMLLKWIGLGFKTYF 466 >SB_9642| Best HMM Match : PSI (HMM E-Value=3.6) Length = 165 Score = 28.7 bits (61), Expect = 5.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 164 VRSVVVLHGCTKPKYQ*ACVYPAILHCI 81 V V+ G T P + C+ PA+LHC+ Sbjct: 81 VAQVIRQSGTTGPTFNQRCLQPALLHCL 108 >SB_22229| Best HMM Match : Arm (HMM E-Value=0) Length = 1050 Score = 27.9 bits (59), Expect = 9.5 Identities = 7/16 (43%), Positives = 14/16 (87%) Frame = -3 Query: 107 VYPAILHCIHDPDAFI 60 ++PA+L+C+ DPD ++ Sbjct: 250 IFPAVLNCLKDPDEYV 265 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,910,593 Number of Sequences: 59808 Number of extensions: 522930 Number of successful extensions: 1167 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 1053 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1167 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2070332524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -