BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1459 (736 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 22 5.2 DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. 21 9.1 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 21 9.1 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 9.1 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 9.1 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 21 9.1 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 9.1 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +2 Query: 494 RTSRRHVLQKTIRLPSTP 547 R SRRH+L+ ++P P Sbjct: 31 RISRRHLLELAEKIPGPP 48 >DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. Length = 135 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +1 Query: 124 LKKLNTVVFPVSYNDKFYKDVLEA 195 +KK N V ++N+K D++ A Sbjct: 67 MKKFNVVDENANFNEKISSDIVRA 90 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.4 bits (43), Expect = 9.1 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +1 Query: 118 KQLKKLNTVVFPVSYNDKFYKDVLEAGELAK 210 +++++ T F Y KF+ + L GEL++ Sbjct: 406 REMRQRITEYFEHRYQGKFFDEELILGELSE 436 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 9.1 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 Query: 592 CRLTTKQHNVLFVNSGL 642 C + T NVLFVNS L Sbjct: 5 CNIWTLAVNVLFVNSFL 21 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 9.1 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 Query: 592 CRLTTKQHNVLFVNSGL 642 C + T NVLFVNS L Sbjct: 5 CNIWTLAVNVLFVNSFL 21 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.4 bits (43), Expect = 9.1 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +1 Query: 118 KQLKKLNTVVFPVSYNDKFYKDVLEAGELAK 210 +++++ T F Y KF+ + L GEL++ Sbjct: 374 REMRQRITEYFEHRYQGKFFDEELILGELSE 404 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 9.1 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 Query: 592 CRLTTKQHNVLFVNSGL 642 C + T NVLFVNS L Sbjct: 5 CNIWTLAVNVLFVNSFL 21 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,520 Number of Sequences: 438 Number of extensions: 4500 Number of successful extensions: 23 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -