BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1457 (734 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY579077-1|AAT81601.1| 101|Anopheles gambiae neuropeptide F pro... 23 7.4 AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 23 9.8 >AY579077-1|AAT81601.1| 101|Anopheles gambiae neuropeptide F protein. Length = 101 Score = 23.4 bits (48), Expect = 7.4 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 172 FRLVGRIQHPASSALP 219 +RL+GRIQH LP Sbjct: 83 YRLIGRIQHFRDEQLP 98 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 23.0 bits (47), Expect = 9.8 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +3 Query: 204 LICSTSYGTHTLSHWARPLSLRASGFYIYIRSRADKTMWK 323 L S +G LSH RP R I S+ D WK Sbjct: 714 LALSKGFGELILSHLLRPFDERELELLISGISKIDVNDWK 753 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 801,232 Number of Sequences: 2352 Number of extensions: 15613 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75260343 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -