BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1456 (1001 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22F8.02c |pvg5|mug50|PvGal biosynthesis protein Pvg5|Schizos... 28 1.8 SPAC22E12.16c |pik1||phosphatidylinositol kinase Pik1|Schizosacc... 27 5.5 SPBC146.09c |lsd1|swm1, saf110|histone demethylase SWIRM1|Schizo... 27 5.5 SPBC16A3.10 |||membrane bound O-acyltransferase, MBOAT |Schizosa... 27 5.5 >SPAC22F8.02c |pvg5|mug50|PvGal biosynthesis protein Pvg5|Schizosaccharomyces pombe|chr 1|||Manual Length = 372 Score = 28.3 bits (60), Expect = 1.8 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = -3 Query: 498 CNKIYL*IGLNITIQKTLVFYSHYMNIQKLPKTESEHPTFHMVLSAL 358 C +++L G I + + L+FYS+ + K ++E+P +H LSAL Sbjct: 17 CLRLFL-FGSLILLLRPLIFYSN----TTMKKLKTEYPIYHRHLSAL 58 >SPAC22E12.16c |pik1||phosphatidylinositol kinase Pik1|Schizosaccharomyces pombe|chr 1|||Manual Length = 851 Score = 26.6 bits (56), Expect = 5.5 Identities = 21/63 (33%), Positives = 31/63 (49%) Frame = -3 Query: 447 LVFYSHYMNIQKLPKTESEHPTFHMVLSALLLMYI*KPEARSESGPRPV*QSVGTIRGRA 268 LVF S IQ K SE+ T ++LS ++L + PE ++GP + Q R Sbjct: 126 LVFMSSSSLIQSQQKI-SENVTPALILSGIMLGGVCVPELLKKAGPIAIAQGRKAPRQDP 184 Query: 267 DEA 259 DE+ Sbjct: 185 DES 187 >SPBC146.09c |lsd1|swm1, saf110|histone demethylase SWIRM1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1000 Score = 26.6 bits (56), Expect = 5.5 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -1 Query: 206 RASAPKGGRAALPAAPEIIQNQTRWGERRSPLSVNNAI 93 R A + GR AL + + +N TR+ +P+SV ++I Sbjct: 104 RRPAGRRGRPALNTSNSLERNGTRYVSAEAPISVKSSI 141 >SPBC16A3.10 |||membrane bound O-acyltransferase, MBOAT |Schizosaccharomyces pombe|chr 2|||Manual Length = 509 Score = 26.6 bits (56), Expect = 5.5 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -2 Query: 877 LTKKYVDEAPILTNYGGSVLXGFLARIKHEG 785 LT K+ +PIL YG + F+AR+K+ G Sbjct: 244 LTPKFAS-SPILLKYGYVCITAFVARMKYYG 273 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,255,285 Number of Sequences: 5004 Number of extensions: 93526 Number of successful extensions: 187 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 179 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 187 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 519268360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -