BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1456 (1001 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81479-1|CAB03944.1| 1043|Caenorhabditis elegans Hypothetical pr... 30 3.0 U58760-4|AAK31462.2| 678|Caenorhabditis elegans Hypothetical pr... 29 6.9 >Z81479-1|CAB03944.1| 1043|Caenorhabditis elegans Hypothetical protein C34F6.1 protein. Length = 1043 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -1 Query: 101 NAILTKEH*PRISPLVPNSCSPGDPLV-LERRP 6 N LT E + P++PN CS G+PL+ L++ P Sbjct: 707 NNFLTLEDCGLVCPVLPNPCSLGEPLLSLQKEP 739 >U58760-4|AAK31462.2| 678|Caenorhabditis elegans Hypothetical protein C27A2.4 protein. Length = 678 Score = 28.7 bits (61), Expect = 6.9 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +3 Query: 510 SQASKWFTIISCLHEYLYYHSVKLFILENKTRNFNIVIFNQIYKEI-LLHLTILHRH 677 S + +F I+C HE YY + LF++ N F I I + +E+ L+ + + RH Sbjct: 343 SDRTPYFRKIACFHEMSYYVLIALFLVGN---IFTIEINETVPEELQLIFVHTVWRH 396 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,650,679 Number of Sequences: 27780 Number of extensions: 532665 Number of successful extensions: 1112 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1074 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1112 length of database: 12,740,198 effective HSP length: 82 effective length of database: 10,462,238 effective search space used: 2626021738 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -