BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1455 (785 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxyge... 24 1.2 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 24 1.2 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 24 1.2 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 4.8 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 22 6.4 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 22 6.4 >AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxygenase protein. Length = 135 Score = 24.2 bits (50), Expect = 1.2 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = -3 Query: 561 FVDFKRCMLNQSKTITVYRLTLTVPRHLVRT*SE-R*SLTESKVFGDDDIEVNEVKKTDK 385 F+DF RC L + + L + VR + + + SKVFG+D+ + ++ K++K Sbjct: 60 FMDF-RCYLRPASGFQSLQFRLLENKLGVRQENRVKYNQNYSKVFGNDEKALEQIAKSEK 118 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 24.2 bits (50), Expect = 1.2 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = -3 Query: 561 FVDFKRCMLNQSKTITVYRLTLTVPRHLVRT*SE-R*SLTESKVFGDDDIEVNEVKKTDK 385 F+DF RC L + + L + VR + + + SKVFG+D+ + ++ K++K Sbjct: 120 FMDF-RCYLRPASGFQSLQFRLLENKLGVRQENRVKYNQNYSKVFGNDEKALEQIAKSEK 178 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 24.2 bits (50), Expect = 1.2 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = -3 Query: 561 FVDFKRCMLNQSKTITVYRLTLTVPRHLVRT*SE-R*SLTESKVFGDDDIEVNEVKKTDK 385 F+DF RC L + + L + VR + + + SKVFG+D+ + ++ K++K Sbjct: 120 FMDF-RCYLRPASGFQSLQFRLLENKLGVRQENRVKYNQNYSKVFGNDEKALEQIAKSEK 178 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.2 bits (45), Expect = 4.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -1 Query: 632 TNVSTYKSDAGVETIKLELQENLISWISNGV 540 T +TYK D + + + L +I+W GV Sbjct: 1315 TFTTTYKEDVTLPCLAVGLPPPVITWKIKGV 1345 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 21.8 bits (44), Expect = 6.4 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = -2 Query: 253 TPQPDTVRDTLAYIP 209 TP+PD + + L ++P Sbjct: 353 TPEPDCIHELLGHMP 367 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 21.8 bits (44), Expect = 6.4 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = -3 Query: 438 KVFGDDDIEVNEVKKTDK 385 KVFG+D+ + ++ K++K Sbjct: 1 KVFGNDEKALEQIAKSEK 18 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,880 Number of Sequences: 336 Number of extensions: 3572 Number of successful extensions: 12 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21272645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -