BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1454 (756 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0292 + 24181486-24181515,24181729-24182616,24182702-241828... 28 9.2 >04_04_0292 + 24181486-24181515,24181729-24182616,24182702-24182854, 24183131-24183185,24184860-24185047,24185271-24185351 Length = 464 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +3 Query: 585 GCVNVVF*WRFRVGNNFFLNLLASYKNLSFLYLIS 689 GC+ + R+GN+ F ++L++ K L +L LIS Sbjct: 173 GCLKQLILTCVRLGNSDFTDVLSTCKKLEYLQLIS 207 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,415,502 Number of Sequences: 37544 Number of extensions: 275698 Number of successful extensions: 432 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 427 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 432 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2016060588 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -