BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1451 (764 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 29 0.054 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 29 0.054 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 22 4.7 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 22 4.7 EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetyla... 22 6.2 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 28.7 bits (61), Expect = 0.054 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = -1 Query: 377 PGPCSRAPSGRDG--GRWPGTLGSWTPRR-*SLCPYARLLHEAKFR 249 PGP S+AP+ + P +G W PRR S P AR +A R Sbjct: 95 PGPLSQAPASQQSLDASDPDAMGKWCPRREWSSPPDARAASDAARR 140 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 28.7 bits (61), Expect = 0.054 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = -1 Query: 377 PGPCSRAPSGRDG--GRWPGTLGSWTPRR-*SLCPYARLLHEAKFR 249 PGP S+AP+ + P +G W PRR S P AR +A R Sbjct: 251 PGPLSQAPASQQSLDASDPDAMGKWCPRREWSSPPDARAASDAARR 296 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 543 SVRDHARWSETLSPSPAPP 487 S+R R+ E L+P P PP Sbjct: 19 SLRKKGRFWECLAPIPQPP 37 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 543 SVRDHARWSETLSPSPAPP 487 S+R R+ E L+P P PP Sbjct: 19 SLRKKGRFWECLAPIPQPP 37 >EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetylase 2B protein. Length = 528 Score = 21.8 bits (44), Expect = 6.2 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +1 Query: 685 RCMCDGEHMFSCPSDSTSDID 747 RC G +CPS DID Sbjct: 56 RCTKSGLKQITCPSGLAFDID 76 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,085 Number of Sequences: 336 Number of extensions: 4093 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20546262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -