BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1450 (676 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 29 0.13 AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. 27 0.72 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 26 1.3 AF515522-1|AAM61889.1| 222|Anopheles gambiae glutathione S-tran... 26 1.3 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 25 1.7 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 25 1.7 AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. 25 1.7 AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprol... 25 2.9 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 25 2.9 AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. 24 3.8 AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. 24 3.8 DQ212025-1|ABB00970.1| 102|Anopheles gambiae defensin protein. 24 5.0 AY645022-1|AAT92558.1| 165|Anopheles gambiae hairy protein. 23 6.7 AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. 23 6.7 AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. 23 6.7 AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. 23 6.7 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 23 6.7 EF588665-1|ABQ96851.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588663-1|ABQ96849.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588662-1|ABQ96848.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588661-1|ABQ96847.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588660-1|ABQ96846.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588659-1|ABQ96845.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588658-1|ABQ96844.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588657-1|ABQ96843.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588656-1|ABQ96842.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588654-1|ABQ96840.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588653-1|ABQ96839.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588651-1|ABQ96838.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588650-1|ABQ96837.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588649-1|ABQ96836.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588647-1|ABQ96835.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588646-1|ABQ96834.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588639-1|ABQ96829.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588637-1|ABQ96827.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588636-1|ABQ96826.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588635-1|ABQ96825.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588634-1|ABQ96824.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588632-1|ABQ96822.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588630-1|ABQ96820.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588629-1|ABQ96819.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588628-1|ABQ96818.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588626-1|ABQ96816.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588625-1|ABQ96815.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588624-1|ABQ96814.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588623-1|ABQ96813.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588622-1|ABQ96812.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588621-1|ABQ96811.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588618-1|ABQ96809.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588617-1|ABQ96808.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588616-1|ABQ96807.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588615-1|ABQ96806.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588614-1|ABQ96805.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588612-1|ABQ96803.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588611-1|ABQ96802.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588610-1|ABQ96801.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588608-1|ABQ96799.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588607-1|ABQ96798.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588606-1|ABQ96797.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588605-1|ABQ96796.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588604-1|ABQ96795.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588603-1|ABQ96794.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588602-1|ABQ96793.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588601-1|ABQ96792.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588595-1|ABQ96786.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588590-1|ABQ96784.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588589-1|ABQ96783.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588588-1|ABQ96782.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588587-1|ABQ96781.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588586-1|ABQ96780.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588585-1|ABQ96779.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588584-1|ABQ96778.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588583-1|ABQ96777.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588582-1|ABQ96776.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588581-1|ABQ96775.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588580-1|ABQ96774.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588579-1|ABQ96773.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588577-1|ABQ96772.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588576-1|ABQ96771.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588571-1|ABQ96769.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588570-1|ABQ96768.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588568-1|ABQ96766.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588567-1|ABQ96765.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588566-1|ABQ96764.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588565-1|ABQ96763.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588564-1|ABQ96762.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588562-1|ABQ96760.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588559-1|ABQ96757.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588558-1|ABQ96756.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588557-1|ABQ96755.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588556-1|ABQ96754.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588554-1|ABQ96752.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588551-1|ABQ63507.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588550-1|ABQ63506.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588549-1|ABQ63505.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588548-1|ABQ63504.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588547-1|ABQ63503.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588546-1|ABQ63502.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588545-1|ABQ63501.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588544-1|ABQ63500.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588543-1|ABQ63499.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588542-1|ABQ63498.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588541-1|ABQ63497.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588540-1|ABQ63496.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588539-1|ABQ63495.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588538-1|ABQ63494.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588537-1|ABQ63493.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588536-1|ABQ63492.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588535-1|ABQ63491.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588534-1|ABQ63490.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588533-1|ABQ63489.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588532-1|ABQ63488.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588531-1|ABQ63487.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588530-1|ABQ63486.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588529-1|ABQ63485.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588528-1|ABQ63484.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588525-1|ABQ63481.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588522-1|ABQ63478.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588521-1|ABQ63477.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588520-1|ABQ63476.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588519-1|ABQ63475.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588518-1|ABQ96750.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588517-1|ABQ96749.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588516-1|ABQ96748.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588515-1|ABQ96747.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588514-1|ABQ96746.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588512-1|ABQ96745.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588509-1|ABQ96744.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588508-1|ABQ96743.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588507-1|ABQ96742.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588506-1|ABQ96741.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588505-1|ABQ96740.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588504-1|ABQ96739.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588503-1|ABQ96738.1| 169|Anopheles gambiae transposase protein. 23 8.8 EF588502-1|ABQ96737.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588501-1|ABQ96736.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588500-1|ABQ96735.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588499-1|ABQ96734.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588498-1|ABQ96733.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588497-1|ABQ96732.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588496-1|ABQ96731.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588493-1|ABQ96729.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588491-1|ABQ96727.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588490-1|ABQ96726.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588489-1|ABQ96725.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588488-1|ABQ96724.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588487-1|ABQ96723.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588486-1|ABQ96722.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588485-1|ABQ96721.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588484-1|ABQ96720.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588483-1|ABQ96719.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588482-1|ABQ96718.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588481-1|ABQ96717.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588480-1|ABQ96716.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588479-1|ABQ96715.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588478-1|ABQ96714.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588477-1|ABQ96713.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588476-1|ABQ96712.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588475-1|ABQ96711.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588474-1|ABQ96710.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588473-1|ABQ96709.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588472-1|ABQ96708.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588471-1|ABQ96707.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588470-1|ABQ96706.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588469-1|ABQ96705.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588468-1|ABQ96704.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588467-1|ABQ96703.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588466-1|ABQ96702.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588465-1|ABQ96701.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588464-1|ABQ96700.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588463-1|ABQ96699.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588462-1|ABQ96698.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588461-1|ABQ96697.1| 176|Anopheles gambiae transposase protein. 23 8.8 EF588460-1|ABQ96696.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588459-1|ABQ96695.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588458-1|ABQ96694.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588454-1|ABQ96690.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588453-1|ABQ96689.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588452-1|ABQ96688.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588451-1|ABQ96687.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588450-1|ABQ96686.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588449-1|ABQ96685.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588448-1|ABQ96684.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588447-1|ABQ96683.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588446-1|ABQ96682.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588445-1|ABQ96681.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588444-1|ABQ96680.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588443-1|ABQ96679.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588442-1|ABQ96678.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588441-1|ABQ96677.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588440-1|ABQ96676.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588439-1|ABQ96675.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588438-1|ABQ96674.1| 177|Anopheles gambiae transposase protein. 23 8.8 EF588437-1|ABQ96673.1| 177|Anopheles gambiae transposase protein. 23 8.8 AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. 23 8.8 >AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-helix transcriptionfactor ASH protein. Length = 371 Score = 29.1 bits (62), Expect = 0.13 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 284 QPQTTHGSPYHVHPYPSPVRLQ 349 QPQ H YH HP+ +PV+ + Sbjct: 317 QPQQQHQQQYHSHPHHTPVQFK 338 >AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 26.6 bits (56), Expect = 0.72 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 2/71 (2%) Frame = +2 Query: 290 QTTHGSPYHVHP-YPSPVRLQHAFQAQSSPKLFHPKGLKPHLDARTFATP-QESPVLGRA 463 Q + P HP P++ Q Q Q P P+ +P + + T Q SP GR+ Sbjct: 4 QYQYAQPQRQHPSLVGPLQQQQQQQQQHGPS--GPQ-YQPGVPLAPYPTETQRSPAYGRS 60 Query: 464 LCLTPRGSPIP 496 T + +P+P Sbjct: 61 QAYTQQPAPVP 71 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 25.8 bits (54), Expect = 1.3 Identities = 21/71 (29%), Positives = 28/71 (39%) Frame = +2 Query: 284 QPQTTHGSPYHVHPYPSPVRLQHAFQAQSSPKLFHPKGLKPHLDARTFATPQESPVLGRA 463 QPQ H P V P + QH S P+ L P+ Q SP GR+ Sbjct: 80 QPQRQH--PSLVGPQLQQQQQQHQQHGPSGPQYQPGVPLAPYP-----TETQRSPAYGRS 132 Query: 464 LCLTPRGSPIP 496 T + +P+P Sbjct: 133 QAYTQQPAPVP 143 >AF515522-1|AAM61889.1| 222|Anopheles gambiae glutathione S-transferase protein. Length = 222 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/40 (27%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +2 Query: 278 CIQPQTTHGSPYHV--HPYPSPVRLQHAFQAQSSPKLFHP 391 C+ PQ + +HV PYP +R+ + + + HP Sbjct: 171 CLVPQVFNARRFHVDLRPYPIILRIDRELEGHPAFRAAHP 210 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 25.4 bits (53), Expect = 1.7 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +2 Query: 284 QPQTTHGSPYHVHPYPSPVRLQHAFQAQSSPKLFHPKGL 400 QP H P+H H P QH Q Q SP+ P + Sbjct: 90 QPPHHHQHPHH-HQLPHHPHHQHHPQQQPSPQTSPPASI 127 Score = 23.8 bits (49), Expect = 5.0 Identities = 11/34 (32%), Positives = 14/34 (41%) Frame = +2 Query: 275 DCIQPQTTHGSPYHVHPYPSPVRLQHAFQAQSSP 376 D PQ+ P+H H SP A +SP Sbjct: 5 DRCSPQSAPSPPHHHHSSQSPTSTTTVTMATASP 38 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 25.4 bits (53), Expect = 1.7 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +2 Query: 284 QPQTTHGSPYHVHPYPSPVRLQHAFQAQSSPKLFHPKGL 400 QP H P+H H P QH Q Q SP+ P + Sbjct: 90 QPPHHHQHPHH-HQLPHHPHHQHHPQQQPSPQTSPPASI 127 Score = 23.8 bits (49), Expect = 5.0 Identities = 11/34 (32%), Positives = 14/34 (41%) Frame = +2 Query: 275 DCIQPQTTHGSPYHVHPYPSPVRLQHAFQAQSSP 376 D PQ+ P+H H SP A +SP Sbjct: 5 DRCSPQSAPSPPHHHHSSQSPTSTTTVTMATASP 38 >AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. Length = 458 Score = 25.4 bits (53), Expect = 1.7 Identities = 16/51 (31%), Positives = 21/51 (41%), Gaps = 3/51 (5%) Frame = +3 Query: 444 VQCWAGLCASHREAARYQAGCLSEREVSRLFDAQL*H---GLFGGQDQRHV 587 +QCW Q GC +E E L+ +Q G GG +RHV Sbjct: 36 IQCWKSRTRDPEGNENVQRGCTTEHEQLPLYCSQNQKPNTGDSGGPKKRHV 86 >AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprolinase protein. Length = 756 Score = 24.6 bits (51), Expect = 2.9 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +3 Query: 177 YSCHICESCIGQIMEENKSKHKTLQN 254 Y+C E C+G+I +E +H TL + Sbjct: 200 YACPEHELCVGRIAQELGFQHVTLSH 225 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 24.6 bits (51), Expect = 2.9 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +3 Query: 177 YSCHICESCIGQIMEENKSKHKTLQN 254 Y+C E C+G+I +E +H TL + Sbjct: 200 YACPEHELCVGRIAQELGFQHVTLSH 225 >AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 24.2 bits (50), Expect = 3.8 Identities = 20/73 (27%), Positives = 30/73 (41%), Gaps = 4/73 (5%) Frame = +2 Query: 290 QTTHGSPYHVHP-YPSPVRLQHAFQAQSSPKLFHPKG--LKPHLDARTFATP-QESPVLG 457 Q + P HP P + QH Q Q P G +P + + T Q +P G Sbjct: 4 QYQYAQPQRQHPSLVGPQQQQHQQQQQQHG----PSGPQYQPGVPLAPYPTETQRAPAYG 59 Query: 458 RALCLTPRGSPIP 496 R+ T + +P+P Sbjct: 60 RSQAYTQQPAPVP 72 >AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 24.2 bits (50), Expect = 3.8 Identities = 20/73 (27%), Positives = 30/73 (41%), Gaps = 4/73 (5%) Frame = +2 Query: 290 QTTHGSPYHVHP-YPSPVRLQHAFQAQSSPKLFHPKG--LKPHLDARTFATP-QESPVLG 457 Q + P HP P + QH Q Q P G +P + + T Q +P G Sbjct: 4 QYQYAQPQRQHPSLVGPQQQQHQQQQQQHG----PSGPQYQPGVPLAPYPTETQRAPAYG 59 Query: 458 RALCLTPRGSPIP 496 R+ T + +P+P Sbjct: 60 RSQAYTQQPAPVP 72 >DQ212025-1|ABB00970.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 456 AGLCASHREAARYQAGCLSEREV 524 + LCA+H A RY+ G + R V Sbjct: 75 SSLCAAHCIARRYRGGYCNSRAV 97 >AY645022-1|AAT92558.1| 165|Anopheles gambiae hairy protein. Length = 165 Score = 23.4 bits (48), Expect = 6.7 Identities = 12/46 (26%), Positives = 27/46 (58%) Frame = +1 Query: 508 YLNEKFQDSLTLNSDTDSLVAKISAMFPTVSETHIKLLLKKYYNRE 645 YL++ Q S + +S + S ++ S+ + ++ + L++KK Y+ E Sbjct: 102 YLHQHQQSSSSSSSSSSSSMSSSSSSSFSSPDSPLSLVMKKPYHDE 147 >AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.4 bits (48), Expect = 6.7 Identities = 19/73 (26%), Positives = 27/73 (36%), Gaps = 4/73 (5%) Frame = +2 Query: 290 QTTHGSPYHVHPY----PSPVRLQHAFQAQSSPKLFHPKGLKPHLDARTFATPQESPVLG 457 Q + P HP P + QH S P+ L P+ Q SP G Sbjct: 4 QYQYAQPQRQHPSLVAGPQQQQQQHQQHGPSGPQYQPGVPLAPYP-----TETQRSPAYG 58 Query: 458 RALCLTPRGSPIP 496 R+ T + +P+P Sbjct: 59 RSQAYTQQPAPVP 71 >AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.4 bits (48), Expect = 6.7 Identities = 19/73 (26%), Positives = 27/73 (36%), Gaps = 4/73 (5%) Frame = +2 Query: 290 QTTHGSPYHVHPY----PSPVRLQHAFQAQSSPKLFHPKGLKPHLDARTFATPQESPVLG 457 Q + P HP P + QH S P+ L P+ Q SP G Sbjct: 4 QYQYAQPQRQHPSLVAGPQQQQQQHQQHGPSGPQYQPGVPLAPYP-----TETQRSPAYG 58 Query: 458 RALCLTPRGSPIP 496 R+ T + +P+P Sbjct: 59 RSQAYTQQPAPVP 71 >AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.4 bits (48), Expect = 6.7 Identities = 19/73 (26%), Positives = 27/73 (36%), Gaps = 4/73 (5%) Frame = +2 Query: 290 QTTHGSPYHVHPY----PSPVRLQHAFQAQSSPKLFHPKGLKPHLDARTFATPQESPVLG 457 Q + P HP P + QH S P+ L P+ Q SP G Sbjct: 4 QYQYAQPQRQHPSLVAGPQQQQQQHQQHGPSGPQYQPGVPLAPYP-----TETQRSPAYG 58 Query: 458 RALCLTPRGSPIP 496 R+ T + +P+P Sbjct: 59 RSQAYTQQPAPVP 71 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.4 bits (48), Expect = 6.7 Identities = 19/73 (26%), Positives = 27/73 (36%), Gaps = 4/73 (5%) Frame = +2 Query: 290 QTTHGSPYHVHPY----PSPVRLQHAFQAQSSPKLFHPKGLKPHLDARTFATPQESPVLG 457 Q + P HP P + QH S P+ L P+ Q SP G Sbjct: 75 QYQYAQPQRQHPSLVAGPQQQQQQHQQHGPSGPQYQPGVPLAPYP-----TETQRSPAYG 129 Query: 458 RALCLTPRGSPIP 496 R+ T + +P+P Sbjct: 130 RSQAYTQQPAPVP 142 >EF588665-1|ABQ96851.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588663-1|ABQ96849.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588662-1|ABQ96848.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588661-1|ABQ96847.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588660-1|ABQ96846.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588659-1|ABQ96845.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588658-1|ABQ96844.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588657-1|ABQ96843.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588656-1|ABQ96842.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588654-1|ABQ96840.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588653-1|ABQ96839.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588651-1|ABQ96838.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588650-1|ABQ96837.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588649-1|ABQ96836.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588647-1|ABQ96835.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588646-1|ABQ96834.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588639-1|ABQ96829.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588637-1|ABQ96827.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588636-1|ABQ96826.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588635-1|ABQ96825.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588634-1|ABQ96824.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588632-1|ABQ96822.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588630-1|ABQ96820.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588629-1|ABQ96819.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588628-1|ABQ96818.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588626-1|ABQ96816.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588625-1|ABQ96815.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588624-1|ABQ96814.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588623-1|ABQ96813.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588622-1|ABQ96812.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588621-1|ABQ96811.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588618-1|ABQ96809.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588617-1|ABQ96808.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588616-1|ABQ96807.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588615-1|ABQ96806.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588614-1|ABQ96805.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588612-1|ABQ96803.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588611-1|ABQ96802.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588610-1|ABQ96801.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588608-1|ABQ96799.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588607-1|ABQ96798.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588606-1|ABQ96797.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588605-1|ABQ96796.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588604-1|ABQ96795.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588603-1|ABQ96794.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588602-1|ABQ96793.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588601-1|ABQ96792.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588595-1|ABQ96786.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588590-1|ABQ96784.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588589-1|ABQ96783.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588588-1|ABQ96782.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588587-1|ABQ96781.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588586-1|ABQ96780.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588585-1|ABQ96779.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588584-1|ABQ96778.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588583-1|ABQ96777.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588582-1|ABQ96776.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588581-1|ABQ96775.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588580-1|ABQ96774.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588579-1|ABQ96773.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588577-1|ABQ96772.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588576-1|ABQ96771.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588571-1|ABQ96769.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588570-1|ABQ96768.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588568-1|ABQ96766.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588567-1|ABQ96765.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588566-1|ABQ96764.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588565-1|ABQ96763.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588564-1|ABQ96762.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588562-1|ABQ96760.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588559-1|ABQ96757.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588558-1|ABQ96756.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588557-1|ABQ96755.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588556-1|ABQ96754.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588554-1|ABQ96752.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588551-1|ABQ63507.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588550-1|ABQ63506.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588549-1|ABQ63505.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588548-1|ABQ63504.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588547-1|ABQ63503.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588546-1|ABQ63502.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588545-1|ABQ63501.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588544-1|ABQ63500.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588543-1|ABQ63499.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588542-1|ABQ63498.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588541-1|ABQ63497.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588540-1|ABQ63496.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588539-1|ABQ63495.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588538-1|ABQ63494.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588537-1|ABQ63493.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588536-1|ABQ63492.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588535-1|ABQ63491.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588534-1|ABQ63490.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588533-1|ABQ63489.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588532-1|ABQ63488.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588531-1|ABQ63487.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588530-1|ABQ63486.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588529-1|ABQ63485.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588528-1|ABQ63484.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588525-1|ABQ63481.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588522-1|ABQ63478.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588521-1|ABQ63477.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588520-1|ABQ63476.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588519-1|ABQ63475.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588518-1|ABQ96750.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588517-1|ABQ96749.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588516-1|ABQ96748.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588515-1|ABQ96747.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588514-1|ABQ96746.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588512-1|ABQ96745.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588509-1|ABQ96744.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588508-1|ABQ96743.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588507-1|ABQ96742.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588506-1|ABQ96741.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588505-1|ABQ96740.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588504-1|ABQ96739.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588503-1|ABQ96738.1| 169|Anopheles gambiae transposase protein. Length = 169 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588502-1|ABQ96737.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588501-1|ABQ96736.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588500-1|ABQ96735.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588499-1|ABQ96734.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588498-1|ABQ96733.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588497-1|ABQ96732.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588496-1|ABQ96731.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588493-1|ABQ96729.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588491-1|ABQ96727.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588490-1|ABQ96726.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588489-1|ABQ96725.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588488-1|ABQ96724.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588487-1|ABQ96723.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588486-1|ABQ96722.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588485-1|ABQ96721.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588484-1|ABQ96720.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588483-1|ABQ96719.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588482-1|ABQ96718.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588481-1|ABQ96717.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588480-1|ABQ96716.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588479-1|ABQ96715.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588478-1|ABQ96714.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588477-1|ABQ96713.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588476-1|ABQ96712.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588475-1|ABQ96711.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588474-1|ABQ96710.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588473-1|ABQ96709.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588472-1|ABQ96708.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588471-1|ABQ96707.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588470-1|ABQ96706.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588469-1|ABQ96705.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588468-1|ABQ96704.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588467-1|ABQ96703.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588466-1|ABQ96702.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588465-1|ABQ96701.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588464-1|ABQ96700.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588463-1|ABQ96699.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588462-1|ABQ96698.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588461-1|ABQ96697.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 84 YFNSNMSIQGYLKKPIN 100 >EF588460-1|ABQ96696.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588459-1|ABQ96695.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588458-1|ABQ96694.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588454-1|ABQ96690.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588453-1|ABQ96689.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588452-1|ABQ96688.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588451-1|ABQ96687.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588450-1|ABQ96686.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588449-1|ABQ96685.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588448-1|ABQ96684.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588447-1|ABQ96683.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588446-1|ABQ96682.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588445-1|ABQ96681.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588444-1|ABQ96680.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588443-1|ABQ96679.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588442-1|ABQ96678.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588441-1|ABQ96677.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588440-1|ABQ96676.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588439-1|ABQ96675.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588438-1|ABQ96674.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >EF588437-1|ABQ96673.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 >AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. Length = 603 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 112 YYNTTISIYVY*KQPVN 62 Y+N+ +SI Y K+P+N Sbjct: 85 YFNSNMSIQGYLKKPIN 101 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 720,678 Number of Sequences: 2352 Number of extensions: 15371 Number of successful extensions: 308 Number of sequences better than 10.0: 195 Number of HSP's better than 10.0 without gapping: 306 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 308 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -