BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1441 (680 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY060674-1|AAL28222.1| 876|Drosophila melanogaster GH10703p pro... 29 5.9 AE014297-2485|AAF55525.1| 876|Drosophila melanogaster CG7146-PA... 29 5.9 >AY060674-1|AAL28222.1| 876|Drosophila melanogaster GH10703p protein. Length = 876 Score = 29.1 bits (62), Expect = 5.9 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = +2 Query: 227 IRSRVAVKMKLIYF--STQGLNLLELRIRILDSKQIKIYLSHMICMRF 364 IR A++ +L++F LN LEL I + D + ++ H +C+ F Sbjct: 126 IRVCCAIRRRLVFFFWKEDKLNSLELIIELSDVPRTLCWVGHAVCVGF 173 >AE014297-2485|AAF55525.1| 876|Drosophila melanogaster CG7146-PA protein. Length = 876 Score = 29.1 bits (62), Expect = 5.9 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = +2 Query: 227 IRSRVAVKMKLIYF--STQGLNLLELRIRILDSKQIKIYLSHMICMRF 364 IR A++ +L++F LN LEL I + D + ++ H +C+ F Sbjct: 126 IRVCCAIRRRLVFFFWKEDKLNSLELIIELSDVPRTLCWVGHAVCVGF 173 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,778,122 Number of Sequences: 53049 Number of extensions: 415421 Number of successful extensions: 763 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 752 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 763 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2971922400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -