BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1436 (653 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 23 2.6 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 23 2.6 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 22 6.0 AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 21 7.9 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 7.9 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 23.0 bits (47), Expect = 2.6 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = -1 Query: 281 LLDLDLEGEVICCGTENEILIWIFFLSVWNHHETFLNPQIYYGIET 144 L+D++L+ +++ T N +W+ WN ++ NP Y G++T Sbjct: 57 LIDVNLKNQIM---TTN---VWVE--QEWNDYKLKWNPDDYGGVDT 94 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 495 KVSQQSRSGSRSKFNSA 545 K+ + RSG +SKFN+A Sbjct: 364 KMHGRGRSGKKSKFNAA 380 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 21.8 bits (44), Expect = 6.0 Identities = 13/45 (28%), Positives = 26/45 (57%) Frame = -1 Query: 281 LLDLDLEGEVICCGTENEILIWIFFLSVWNHHETFLNPQIYYGIE 147 L++++L+ +V+ T N +W+ WN ++ NP+ Y G+E Sbjct: 70 LIEMNLKNQVM---TTN---VWVE--QRWNDYKLKWNPEEYGGVE 106 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = -2 Query: 649 WLHLHQSLSWQGSLTCFCC 593 +L + S WQ +C CC Sbjct: 60 YLQVSGSKIWQMERSCMCC 78 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/26 (34%), Positives = 11/26 (42%) Frame = +3 Query: 195 PHTQEKNPDQNLVLGPAAYHFSLQVQ 272 PH Q N +GP +H Q Q Sbjct: 334 PHHQHGNHTMGPTMGPPHHHHHHQTQ 359 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,951 Number of Sequences: 438 Number of extensions: 3375 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -