BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1435 (653 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 22 6.0 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 6.0 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 21 7.9 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 21.8 bits (44), Expect = 6.0 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +1 Query: 208 FCGVTCQR*LGTSGCRNHLVNGDPRRI 288 +C V+C R L G + +VN +P + Sbjct: 398 WCAVSCLRELRNLGRKTIMVNYNPETV 424 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -3 Query: 330 YVVMDIGDSSEPGQDPARVSIDKMVATTAGTK 235 Y+ MD+ S+ + +SID+ +A T K Sbjct: 262 YIAMDVTCSTSSIFNLVAISIDRYIAVTQPIK 293 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -2 Query: 313 RGQLRTWPGSGEG 275 RGQLRT SGEG Sbjct: 396 RGQLRTKIESGEG 408 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,559 Number of Sequences: 438 Number of extensions: 4895 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -