BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1434 (678 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_07_0065 - 12527642-12528178,12531443-12531718 29 3.4 05_07_0076 - 27520152-27520379,27520785-27521096,27521194-275213... 28 6.0 01_01_0939 - 7404209-7404490,7405057-7405368,7405470-7405609,740... 28 6.0 07_03_1097 + 23938079-23938570 28 7.9 05_06_0057 + 25253497-25253589,25253722-25253799,25254583-252546... 28 7.9 01_01_0453 - 3361460-3361549,3361660-3361846,3362038-3362139,336... 28 7.9 >10_07_0065 - 12527642-12528178,12531443-12531718 Length = 270 Score = 29.1 bits (62), Expect = 3.4 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +1 Query: 316 RIVVKEINGCDGSFIVNC-VISYCIKRNSPLLIVSSHNSITHYHNVGLRM 462 RI++ + G G F+V C V+S C+K + + H+H L M Sbjct: 108 RIIIAAVAGA-GGFVVACGVLSRCVKAEAAAAAANGRRHHHHHHTTMLLM 156 >05_07_0076 - 27520152-27520379,27520785-27521096,27521194-27521333, 27521893-27521956,27522071-27522277,27522350-27522493, 27522578-27522709,27522880-27524294,27524647-27524920, 27526096-27526129,27527028-27527059 Length = 993 Score = 28.3 bits (60), Expect = 6.0 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = +1 Query: 436 HYHNVGLRMNHNLFKS 483 HYH+ GLR+N NL++S Sbjct: 817 HYHSGGLRLNPNLYES 832 >01_01_0939 - 7404209-7404490,7405057-7405368,7405470-7405609, 7406226-7406289,7406378-7406616,7406957-7406983, 7407590-7407749 Length = 407 Score = 28.3 bits (60), Expect = 6.0 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = +1 Query: 436 HYHNVGLRMNHNLFKS 483 HYH+ GLR+N NL++S Sbjct: 213 HYHSGGLRLNPNLYES 228 >07_03_1097 + 23938079-23938570 Length = 163 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 581 EKNRRNAA*S*HS*HYFDGITHLLD 655 E+ RRNAA + HYF G+ H D Sbjct: 102 ERRRRNAALAHVEKHYFPGVVHFAD 126 >05_06_0057 + 25253497-25253589,25253722-25253799,25254583-25254621, 25254724-25255263,25255352-25255450,25255614-25255691, 25255961-25256146,25256240-25256365 Length = 412 Score = 27.9 bits (59), Expect = 7.9 Identities = 9/37 (24%), Positives = 23/37 (62%) Frame = +1 Query: 361 VNCVISYCIKRNSPLLIVSSHNSITHYHNVGLRMNHN 471 V+C YC++ P ++ S ++ +HY++ ++M+ + Sbjct: 292 VSCRYKYCVQCLVPTAMMGSSHAASHYNSQSMQMDRS 328 >01_01_0453 - 3361460-3361549,3361660-3361846,3362038-3362139, 3362239-3362306,3362976-3363175,3363253-3363595, 3363837-3363893,3364011-3364727,3364805-3365007, 3365171-3365297 Length = 697 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +3 Query: 519 DATLTNIMEYAESDQLLIDVLKKIEEMQR 605 D + EYAE Q++ D+ KK EEM++ Sbjct: 338 DTSFVQCHEYAELYQIINDLSKKTEEMEK 366 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,234,159 Number of Sequences: 37544 Number of extensions: 261586 Number of successful extensions: 556 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 547 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 556 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1726796312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -