BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1434 (678 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 31 0.033 DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor... 23 8.9 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 23 8.9 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 31.1 bits (67), Expect = 0.033 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = -1 Query: 147 IYLIRKLLLFNNMVLMTLYPKKLNTLFLFLFPVH 46 +Y+I K ++ N V L P+KLNT+ LFP H Sbjct: 348 VYVILKRMVGGNRVPKELDPEKLNTIIDELFPSH 381 >DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor 24 protein. Length = 378 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 460 MNHNLFKSCEAGVIDYLILVTQ 525 +N LFKS A ++ YL+++ Q Sbjct: 336 VNRTLFKSLLATMVTYLVVLLQ 357 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = +1 Query: 355 FIVNCVISYCIKRNSPLLIVSSHNSITHYHNV 450 F++ C+I C P + ++ SI H +++ Sbjct: 857 FVLACLIQICTMMGLPWFVAATVLSINHVNSL 888 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 661,425 Number of Sequences: 2352 Number of extensions: 12200 Number of successful extensions: 19 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68159265 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -