BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1432 (710 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-3185|AAG22188.1| 1542|Drosophila melanogaster CG9485-PA... 29 4.7 AE013599-3184|AAF46713.3| 1546|Drosophila melanogaster CG9485-PC... 29 4.7 AE013599-3183|AAM70868.2| 1629|Drosophila melanogaster CG9485-PB... 29 4.7 >AE013599-3185|AAG22188.1| 1542|Drosophila melanogaster CG9485-PA, isoform A protein. Length = 1542 Score = 29.5 bits (63), Expect = 4.7 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = -2 Query: 316 NYFFNFIIFREMLKNY--NCRFKSIK*VIHPQYKRLFRTRLMNNTKAIVIF 170 N F + + RE KN CRF+ I+ + PQY+RL T +N A+ IF Sbjct: 335 NEFMSQVRTREPPKNVANECRFQEIQLIQDPQYRRLAST--INFELALEIF 383 >AE013599-3184|AAF46713.3| 1546|Drosophila melanogaster CG9485-PC, isoform C protein. Length = 1546 Score = 29.5 bits (63), Expect = 4.7 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = -2 Query: 316 NYFFNFIIFREMLKNY--NCRFKSIK*VIHPQYKRLFRTRLMNNTKAIVIF 170 N F + + RE KN CRF+ I+ + PQY+RL T +N A+ IF Sbjct: 339 NEFMSQVRTREPPKNVANECRFQEIQLIQDPQYRRLAST--INFELALEIF 387 >AE013599-3183|AAM70868.2| 1629|Drosophila melanogaster CG9485-PB, isoform B protein. Length = 1629 Score = 29.5 bits (63), Expect = 4.7 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = -2 Query: 316 NYFFNFIIFREMLKNY--NCRFKSIK*VIHPQYKRLFRTRLMNNTKAIVIF 170 N F + + RE KN CRF+ I+ + PQY+RL T +N A+ IF Sbjct: 422 NEFMSQVRTREPPKNVANECRFQEIQLIQDPQYRRLAST--INFELALEIF 470 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,565,412 Number of Sequences: 53049 Number of extensions: 525387 Number of successful extensions: 685 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 679 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 685 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3149551053 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -