BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1432 (710 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC084154-10|AAK29873.1| 1140|Caenorhabditis elegans Hypothetical... 29 4.3 Z81058-11|CAH60760.1| 201|Caenorhabditis elegans Hypothetical p... 28 5.7 >AC084154-10|AAK29873.1| 1140|Caenorhabditis elegans Hypothetical protein Y22D7AR.2 protein. Length = 1140 Score = 28.7 bits (61), Expect = 4.3 Identities = 12/50 (24%), Positives = 26/50 (52%) Frame = -2 Query: 160 CFFFKQKTHFSCRIMYT*FSLTNLSYLLEFFYFQTFIYYYKEKSVIYRRL 11 C ++K R+M+ S+ ++ +L+ FF FQ ++Y + + R+ Sbjct: 61 CISKREKCVNLKRLMFERLSINDILFLIPFFNFQVLQFWYSDTKDRFERI 110 >Z81058-11|CAH60760.1| 201|Caenorhabditis elegans Hypothetical protein F11E6.11 protein. Length = 201 Score = 28.3 bits (60), Expect = 5.7 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 4/57 (7%) Frame = -1 Query: 164 LVFFFQTENSFF----LPHHVYII*SNKFVISFRVLLLSNIYILLQRKISYISTLER 6 ++ FF++ + FF +P Y++ FV+SF +LLLS I+ I+ + L+R Sbjct: 138 IIGFFRSFSVFFNGSIMPDCSYLVIWPTFVLSFLILLLSIFVIIYYSCIACCTILDR 194 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,360,909 Number of Sequences: 27780 Number of extensions: 320149 Number of successful extensions: 653 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 641 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 653 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1655655746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -