BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1429 (730 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3G9.07c |hos2|hda1, phd1|histone deacetylase |Schizosaccharo... 29 0.90 SPBC800.03 |clr3||histone deacetylase |Schizosaccharomyces pombe... 27 2.1 SPBC36.05c |clr6||histone deacetylase |Schizosaccharomyces pombe... 26 6.3 >SPAC3G9.07c |hos2|hda1, phd1|histone deacetylase |Schizosaccharomyces pombe|chr 1|||Manual Length = 434 Score = 28.7 bits (61), Expect = 0.90 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 Query: 604 FSGILKAAFNEFKPDIVVYNAGTDILDTDPLG 699 F I++ N F+P +V G D L D LG Sbjct: 259 FKSIIEPTINTFQPSAIVLQCGADSLGYDRLG 290 >SPBC800.03 |clr3||histone deacetylase |Schizosaccharomyces pombe|chr 2|||Manual Length = 687 Score = 27.5 bits (58), Expect = 2.1 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +1 Query: 592 FIFDFSGILKAAFNEFKPDIVVYNAGTDILDTDPLG 699 +I+ F ++ EF PD+V+ + G D D +G Sbjct: 300 YIYAFQRVVMPVAYEFDPDLVIVSCGFDAAAGDHIG 335 >SPBC36.05c |clr6||histone deacetylase |Schizosaccharomyces pombe|chr 2|||Manual Length = 405 Score = 25.8 bits (54), Expect = 6.3 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +1 Query: 604 FSGILKAAFNEFKPDIVVYNAGTDILDTDPLG 699 F ++ F+P+ V+ GTD L D LG Sbjct: 238 FKPVISHIMQWFRPEAVILQCGTDSLAGDRLG 269 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,020,268 Number of Sequences: 5004 Number of extensions: 61020 Number of successful extensions: 151 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 145 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 151 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 343230174 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -