BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1429 (730 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 30 1.7 SB_33165| Best HMM Match : ABC_tran (HMM E-Value=0) 29 5.1 SB_12671| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 29 5.1 >SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) Length = 496 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +1 Query: 592 FIFDFSGILKAAFNEFKPDIVVYNAGTDILDTDPLGH 702 +I F IL EF PDIV+ +AG D DP G+ Sbjct: 396 YIAAFQQILLPIAYEFDPDIVLVSAGFDSARGDPKGY 432 >SB_33165| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1310 Score = 28.7 bits (61), Expect = 5.1 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +3 Query: 369 FLYIILLYGHVHNMQFTSLHIYIAEVHERR 458 FL+II+LYG + QF L A V +RR Sbjct: 238 FLFIIMLYGQLAAKQFAKLRGKAAAVTDRR 267 >SB_12671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 592 FIFDFSGILKAAFNEFKPDIVVYNAGTDILDTDPL 696 F+ F+ ++ +FKPD +V G D L DP+ Sbjct: 247 FVEVFTRVMSRVKAKFKPDAIVCQCGVDSLAGDPM 281 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 28.7 bits (61), Expect = 5.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 Query: 369 FLYIILLYGHVHNMQFTSLHIYIAEVHE 452 FL + L GH+ N+ + +LH Y+ + HE Sbjct: 21 FLMALGLNGHLGNLSYMNLHDYLCKGHE 48 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,424,776 Number of Sequences: 59808 Number of extensions: 408838 Number of successful extensions: 890 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 795 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 889 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1949964354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -