BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1421 (599 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42847-3|AAA83605.2| 210|Caenorhabditis elegans Hypothetical pr... 31 0.83 U80441-11|AAB37660.3| 1037|Caenorhabditis elegans Hypothetical p... 28 5.9 >U42847-3|AAA83605.2| 210|Caenorhabditis elegans Hypothetical protein F39H12.3 protein. Length = 210 Score = 30.7 bits (66), Expect = 0.83 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 4/73 (5%) Frame = +3 Query: 390 EQAATKIQAAFRGHRTR---KSMSMKAAKQEPCKPEPVPTKADWKQ-SLNLMIKNCATPQ 557 + AATKIQAAF+GH R + M K + K D K+ S+ + TP+ Sbjct: 82 DTAATKIQAAFKGHLVRAHPEKYGMSTRTSSSEKLDSANNKKDQKRHSVGGYTIDVDTPE 141 Query: 558 PRFRLRSEATRRG 596 R + ++ RG Sbjct: 142 DRAATKIQSEIRG 154 Score = 27.9 bits (59), Expect = 5.9 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = +3 Query: 387 EEQAATKIQAAFRGHRTRKSMSMKAAKQE 473 E++AATKIQ+ RG TRK + K K++ Sbjct: 141 EDRAATKIQSEIRGFLTRKHVD-KMKKED 168 Score = 27.9 bits (59), Expect = 5.9 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +3 Query: 381 KSEEQAATKIQAAFRGHRTRKSM 449 K + AATKIQA RG TRK + Sbjct: 166 KEDTDAATKIQAHIRGFLTRKHL 188 Score = 27.5 bits (58), Expect = 7.7 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +2 Query: 515 AEFKSDDKELCHAATKIQASFRGHQAR 595 AE + + AATKIQA+F+GH R Sbjct: 72 AEVERPASPMDTAATKIQAAFKGHLVR 98 >U80441-11|AAB37660.3| 1037|Caenorhabditis elegans Hypothetical protein F27C1.11 protein. Length = 1037 Score = 27.9 bits (59), Expect = 5.9 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = +3 Query: 393 QAATKIQAAFRGHRTRK 443 +AATKIQAA++G+ RK Sbjct: 553 EAATKIQAAYKGYTVRK 569 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,316,862 Number of Sequences: 27780 Number of extensions: 225392 Number of successful extensions: 642 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 619 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 642 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1279376318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -