BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1420 (696 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_46036| Best HMM Match : PSRT (HMM E-Value=1) 33 0.22 SB_38155| Best HMM Match : DUF414 (HMM E-Value=4.4) 30 1.6 SB_19556| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_30241| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 29 3.6 SB_24921| Best HMM Match : Pyr_redox (HMM E-Value=4.7e-15) 29 4.8 SB_57582| Best HMM Match : efhand (HMM E-Value=3.8e-05) 28 6.3 SB_24914| Best HMM Match : Nuc_sug_transp (HMM E-Value=3.6e-15) 28 6.3 SB_20266| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_15794| Best HMM Match : DUF1605 (HMM E-Value=5.9e-12) 28 6.3 SB_50392| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_5276| Best HMM Match : DNA_RNApol_7kD (HMM E-Value=1.1) 28 6.3 SB_54008| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_44922| Best HMM Match : RNA_pol_Rpb1_1 (HMM E-Value=0) 28 8.3 SB_43367| Best HMM Match : SAM_1 (HMM E-Value=0.085) 28 8.3 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 28 8.3 SB_29576| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) 28 8.3 SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) 28 8.3 SB_38167| Best HMM Match : Collagen (HMM E-Value=7e-12) 28 8.3 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 35.9 bits (79), Expect = 0.031 Identities = 30/98 (30%), Positives = 42/98 (42%), Gaps = 3/98 (3%) Frame = +1 Query: 1 PERQSPSRASP---RTLRERRRVRHPXSLRAPPHRVSRPQLRRPPPYPARQLGSPSHSIQ 171 P R P R SP RT +RRR R +PP R P+ R P P R+ + S+ Sbjct: 1063 PRRSRPQRTSPSPRRTPEDRRRSRGSRRSPSPPKR--EPRRRSPSASPPRR-EARKRSLS 1119 Query: 172 R*ARGTILQRIRSCSNTTRKGGGGVAFGDIFSPPSTRA 285 R + + +R + RK V G+ +PP A Sbjct: 1120 RSPKREVRRRGSPSPSEGRKKPVDVEMGEEEAPPCKAA 1157 >SB_46036| Best HMM Match : PSRT (HMM E-Value=1) Length = 878 Score = 33.1 bits (72), Expect = 0.22 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +1 Query: 19 SRASPRTLRERRRVRHPXSLRAPPHRVSRPQLRRPPPYPARQLGSPS 159 +++ R+ R+ R + R+PP R P RRP P P R+ SPS Sbjct: 538 TKSPSRSYTSPRQRRTSPNNRSPPPRRRSPSPRRPSPSPRRRSTSPS 584 Score = 29.1 bits (62), Expect = 3.6 Identities = 21/60 (35%), Positives = 25/60 (41%), Gaps = 4/60 (6%) Frame = +1 Query: 1 PERQSPSRASPRTLRERRRVRHPXSLRAPPHRVSRPQ----LRRPPPYPARQLGSPSHSI 168 P R+SPS P RRR P PP RV R Q RR +P R + P + Sbjct: 562 PRRRSPSPRRPSP-SPRRRSTSPSRKSPPPRRVHRHQDVVHPRRDVVHPRRDVVHPRQDV 620 >SB_38155| Best HMM Match : DUF414 (HMM E-Value=4.4) Length = 361 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 77 SAHRLTASHGLSSVGPRHTRHVSWARRHTQFSAEPAVR 190 S +L A+H V P+H R S R +Q S EP ++ Sbjct: 258 SVEKLQAAHDKIKVKPKHRRPPSRVRTSSQVSTEPPIK 295 >SB_19556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 445 Score = 29.5 bits (63), Expect = 2.7 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = +1 Query: 16 PSRASPRTLRER---RRVRHPXSLRAPPHRVSRPQLRRPPPYPARQ 144 P+ SP TL E+ + P SL H + L RPPP P ++ Sbjct: 101 PAPNSPLTLHEQFLSKTPLPPPSLEVSSHEAFQETLHRPPPSPVQE 146 >SB_30241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 91 HRVSRPQLRRPPPYPARQLGSPSHS 165 H+ RP+ RRPPP+ R+ G P S Sbjct: 74 HQEERPRGRRPPPWWRRRRGPPRKS 98 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 29.1 bits (62), Expect = 3.6 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +1 Query: 88 PHRVSRPQLRRPPPYPARQLGSPSHSIQR 174 P + +P +R+P P+ + +G P H++Q+ Sbjct: 1145 PQQYRQPYIRQPKPHHIQAMGPPHHTMQQ 1173 >SB_24921| Best HMM Match : Pyr_redox (HMM E-Value=4.7e-15) Length = 256 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = -3 Query: 217 CCRNGFVEESYRGLSAELSVTASPADVPGMAGADGAEAVRRGEAVRGDXLGDARGD 50 C G+++ S ++A+LSV A+ P G E R G+ V L + D Sbjct: 167 CTEQGYIDASGELIAADLSVWAAGVKAPAFVTTLGMETNRIGQLVVKPTLQSVQDD 222 >SB_57582| Best HMM Match : efhand (HMM E-Value=3.8e-05) Length = 520 Score = 28.3 bits (60), Expect = 6.3 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +1 Query: 10 QSPSR-ASPRTLRERRRVRHPXSLRAPPHRVSRPQLRRPPPYPARQLGSPS 159 Q P R +SP+ + R P R+P +R S PQ R P PA SPS Sbjct: 286 QLPKRPSSPQRPKSPNRPASPQRPRSP-NRPSSPQRPRSPNRPASTSQSPS 335 >SB_24914| Best HMM Match : Nuc_sug_transp (HMM E-Value=3.6e-15) Length = 979 Score = 28.3 bits (60), Expect = 6.3 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = -3 Query: 205 GFVEESYRGLSAELSVTASPADVPGMAGADGAEAVRRGEAVRGDXLGDARGDARGE 38 G E+ G A + A A G A G EA+ GEA +A G+A GE Sbjct: 646 GVAGEAVEGSEASKAGEAGEAVEAGEASEAG-EAIEAGEAGEASEASEAAGEATGE 700 >SB_20266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 28.3 bits (60), Expect = 6.3 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +1 Query: 31 PRTLRERRRVRHPXSLRAPPHRVSRPQLRRPPPYPARQLGSPSHSI 168 P T+RER + +P + R RP + + P RQL S H I Sbjct: 107 PPTVRERTKRINPRFALSRTRRTPRPDVYQSRPSQRRQLPSYQHLI 152 >SB_15794| Best HMM Match : DUF1605 (HMM E-Value=5.9e-12) Length = 655 Score = 28.3 bits (60), Expect = 6.3 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 3/62 (4%) Frame = +1 Query: 7 RQSPSRASPRTLRERRRVRHPXSLRA---PPHRVSRPQLRRPPPYPARQLGSPSHSIQR* 177 R P R +P ++RR R P + P R +RP+ P YP ++ P S + Sbjct: 531 RARPERINPELYPKQRRAR-PERINPELYPKQRRARPERINPELYPKQRRARPESSYESR 589 Query: 178 AR 183 +R Sbjct: 590 SR 591 >SB_50392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.3 bits (60), Expect = 6.3 Identities = 17/49 (34%), Positives = 22/49 (44%) Frame = +1 Query: 1 PERQSPSRASPRTLRERRRVRHPXSLRAPPHRVSRPQLRRPPPYPARQL 147 P P R SP R R R+R P R Q+R+PP +P +L Sbjct: 73 PTFPPPLRPSPNR-RWRARLREVRRSGNQPERQRSIQIRQPPAWPTHRL 120 >SB_5276| Best HMM Match : DNA_RNApol_7kD (HMM E-Value=1.1) Length = 886 Score = 28.3 bits (60), Expect = 6.3 Identities = 22/63 (34%), Positives = 29/63 (46%), Gaps = 8/63 (12%) Frame = -3 Query: 223 SYCCRNGFVEESYRGLSAELSVTA-------SPADVPGMAGADGAEA-VRRGEAVRGDXL 68 S CC G +E S S T+ SPA+ PG G+D +A V R V+G+ Sbjct: 462 SSCCSEGSIEYQEVSHSRHSSSTSEATSYQNSPANYPGDFGSDDTQASVARPIPVQGEKF 521 Query: 67 GDA 59 G A Sbjct: 522 GPA 524 >SB_54008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1940 Score = 27.9 bits (59), Expect = 8.3 Identities = 20/66 (30%), Positives = 29/66 (43%), Gaps = 8/66 (12%) Frame = +1 Query: 1 PERQSPSRASPRTLRERRRVRHPXSLRAPPHR------VSRPQLRRPP--PYPARQLGSP 156 P+RQ P ++ + ER + H + PP R S P L R P P+R + Sbjct: 1354 PQRQRPEKSDSHSSGERYTIEHRGTDPVPPPRSDLTRHQSDPSLSRDTSRPSPSRDMTRS 1413 Query: 157 SHSIQR 174 S +I R Sbjct: 1414 SETIPR 1419 >SB_44922| Best HMM Match : RNA_pol_Rpb1_1 (HMM E-Value=0) Length = 1596 Score = 27.9 bits (59), Expect = 8.3 Identities = 21/67 (31%), Positives = 29/67 (43%), Gaps = 2/67 (2%) Frame = -3 Query: 220 YCCRNGFVEESYRGLSAELSVTASPADVPGMAG--ADGAEAVRRGEAVRGDXLGDARGDA 47 Y +G E+ A + A A G AG ++ EA GEA G+A G+A Sbjct: 10 YAVDSGVASEASETGEASEASEAGEASETGEAGKASEAGEASETGEASEASETGEATGEA 69 Query: 46 RGECAVT 26 GE + T Sbjct: 70 -GEASET 75 >SB_43367| Best HMM Match : SAM_1 (HMM E-Value=0.085) Length = 325 Score = 27.9 bits (59), Expect = 8.3 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = +1 Query: 28 SPRTLRERRRVRHPXSLRAP---PHRVSRPQLRRPPPYPARQ 144 S R L+ + R P L P P V RP PPP PA++ Sbjct: 107 SVRVLKSPLKDREPAPLPVPTMAPTPVPRPSDTNPPPLPAKR 148 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 27.9 bits (59), Expect = 8.3 Identities = 20/57 (35%), Positives = 26/57 (45%) Frame = +1 Query: 4 ERQSPSRASPRTLRERRRVRHPXSLRAPPHRVSRPQLRRPPPYPARQLGSPSHSIQR 174 E + PSR+ + RE R+ RH PH S P PPP P + + S I R Sbjct: 791 EERDPSRSPWASHREERKRRH------TPHEDSPPP-PPPPPPPPEEPSNKSRVIDR 840 >SB_29576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1202 Score = 27.9 bits (59), Expect = 8.3 Identities = 19/60 (31%), Positives = 21/60 (35%) Frame = +1 Query: 91 HRVSRPQLRRPPPYPARQLGSPSHSIQR*ARGTILQRIRSCSNTTRKGGGGVAFGDIFSP 270 HRV P R P P RQ S S AR I+ S G G +F P Sbjct: 780 HRVVEPSFRAPKPASKRQQSSIDTSSSTFARPMAAPSIKCSSPGLTISGSFKPKGSVFKP 839 >SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 514 Score = 27.9 bits (59), Expect = 8.3 Identities = 18/62 (29%), Positives = 26/62 (41%) Frame = +1 Query: 4 ERQSPSRASPRTLRERRRVRHPXSLRAPPHRVSRPQLRRPPPYPARQLGSPSHSIQR*AR 183 +R+ R S + R RH R+P + SR + R PP + R SI R R Sbjct: 54 DRRGGKRRSFSRSKSRTPPRHRRRSRSPNKKHSRSKSRTPPRHRRRSRSPRRESIDRKRR 113 Query: 184 GT 189 + Sbjct: 114 SS 115 >SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) Length = 627 Score = 27.9 bits (59), Expect = 8.3 Identities = 18/45 (40%), Positives = 23/45 (51%) Frame = +1 Query: 1 PERQSPSRASPRTLRERRRVRHPXSLRAPPHRVSRPQLRRPPPYP 135 P Q + +S T+ E + HP S+ PP R S PQ PPP P Sbjct: 129 PPLQEAAFSSRHTV-EVHGLAHP-SITQPPPRHSPPQTPVPPPPP 171 >SB_38167| Best HMM Match : Collagen (HMM E-Value=7e-12) Length = 299 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 148 PADVPGMAGADGAEAVRRGEAVRGD 74 PA PG GADG + +R ++G+ Sbjct: 159 PAGPPGQPGADGKQGIRGPPGIKGE 183 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,563,854 Number of Sequences: 59808 Number of extensions: 405138 Number of successful extensions: 1454 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 1213 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1443 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -