BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1416 (808 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69977-1|CAA93817.1| 151|Anopheles gambiae ribosomal protein RS... 24 4.8 AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. 24 4.8 AY330182-1|AAQ16288.1| 181|Anopheles gambiae odorant-binding pr... 24 6.3 >Z69977-1|CAA93817.1| 151|Anopheles gambiae ribosomal protein RS11 protein. Length = 151 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +1 Query: 253 PLFKTIHTNIMQ*NKILSSTSRFSE 327 PL KT+ N+++ +K+ S +FS+ Sbjct: 126 PLSKTVRFNVLKESKMAGSKKKFSK 150 >AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. Length = 391 Score = 24.2 bits (50), Expect = 4.8 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Frame = +1 Query: 253 PLFKTIHTNIM--Q*NKILSSTSRFSERHDANPSSSIRISDVV*HFDASLKRFR 408 PL K I Q N + + R+ ++ A+P+ S+ DVV DA++ F+ Sbjct: 59 PLNKYCENKIQADQYNLVPLTCIRWRSQNPASPAGSLGGKDVVSKIDAAMANFK 112 >AY330182-1|AAQ16288.1| 181|Anopheles gambiae odorant-binding protein AgamOBP56 protein. Length = 181 Score = 23.8 bits (49), Expect = 6.3 Identities = 9/41 (21%), Positives = 23/41 (56%) Frame = +2 Query: 104 AENQNILNSNRFELINDASEQDENMANEVREICYMATKQNC 226 +E Q+ +++ NDA+ ++ +E+++ C+M + C Sbjct: 22 SEVQDDKCKRKYKCCNDANTENMEKIHEIKKQCFMEMEVIC 62 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 751,962 Number of Sequences: 2352 Number of extensions: 13879 Number of successful extensions: 27 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 85239615 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -