BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1415 (748 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1577 - 27869596-27869682,27869769-27869869,27869956-278699... 30 2.2 05_03_0261 + 11214086-11214148,11215019-11215462,11216504-112166... 29 3.0 09_02_0479 - 9753161-9753171,9755260-9755547,9755883-9756222 29 3.9 01_01_0829 + 6471032-6471870,6472490-6472685,6472772-6472956,647... 29 3.9 06_03_0165 - 17399535-17400178,17400378-17400522 29 5.2 09_04_0276 - 16306894-16307526,16307556-16308572 28 6.9 03_05_0070 - 20478396-20478505,20478605-20478780,20481162-204812... 28 9.1 02_03_0171 + 15945591-15945681,15947068-15947138,15947715-159478... 28 9.1 01_06_0241 - 27813076-27813622,27813695-27814125 28 9.1 >07_03_1577 - 27869596-27869682,27869769-27869869,27869956-27869995, 27870879-27870953 Length = 100 Score = 29.9 bits (64), Expect = 2.2 Identities = 10/25 (40%), Positives = 19/25 (76%) Frame = +3 Query: 117 DLKSQLEGFNTSCLRDVDTNEKIVL 191 DL+S+L+ NT CL + + N+K+++ Sbjct: 54 DLQSKLDAVNTECLAEKEKNKKLII 78 >05_03_0261 + 11214086-11214148,11215019-11215462,11216504-11216666, 11218145-11218441,11218842-11218858 Length = 327 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/48 (29%), Positives = 29/48 (60%) Frame = +2 Query: 218 EDPEVFIRRYREVDSSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGI 361 E+ E I++ RE++S +KH+ET+++ + + + ++ LNGI Sbjct: 172 EEIEENIQKTREIESEIVKHSETEKEYIMKESELMKGVSIAEFELNGI 219 >09_02_0479 - 9753161-9753171,9755260-9755547,9755883-9756222 Length = 212 Score = 29.1 bits (62), Expect = 3.9 Identities = 11/24 (45%), Positives = 19/24 (79%) Frame = +1 Query: 124 RVSSKASTPAVSVTSTPMKRLCFR 195 +VSS++S+P SVT+ ++ +CFR Sbjct: 72 QVSSQSSSPVESVTTATLRPICFR 95 >01_01_0829 + 6471032-6471870,6472490-6472685,6472772-6472956, 6473206-6473539,6473629-6473833,6474927-6475033, 6475117-6475269 Length = 672 Score = 29.1 bits (62), Expect = 3.9 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +1 Query: 79 TLPP*KTSPRSPQT*RVSSKASTPAVSVTST 171 TLPP + SP SP T SSK TP+ S S+ Sbjct: 31 TLPPGRLSPVSPLTHSSSSKLPTPSSSSGSS 61 >06_03_0165 - 17399535-17400178,17400378-17400522 Length = 262 Score = 28.7 bits (61), Expect = 5.2 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +3 Query: 573 YNGNTAWAMATYSNPGFYSNPNDKSRLTPINSEWTP 680 ++G W T G YS D +RLT I SE P Sbjct: 221 FSGEYRWCYPTPVREGIYSLATDANRLTTIFSEENP 256 >09_04_0276 - 16306894-16307526,16307556-16308572 Length = 549 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -3 Query: 710 YTNYLY*IGLWRPLAVYWRKAR 645 +T Y Y LW P YWR+AR Sbjct: 111 HTTYNYTDILWSPYGAYWRQAR 132 >03_05_0070 - 20478396-20478505,20478605-20478780,20481162-20481265, 20481346-20481504,20481718-20481857,20482222-20482311, 20482902-20482970,20484295-20484516,20486175-20486293, 20486377-20486492,20488058-20488146,20488790-20488883 Length = 495 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +3 Query: 93 KDLPKVATDLKSQLEGFNTSCLRDVDTNEKI 185 K+L + DLKS+LEG+NT D++ + + Sbjct: 266 KELDERRHDLKSELEGYNTGDSDDINKKKAL 296 >02_03_0171 + 15945591-15945681,15947068-15947138,15947715-15947817, 15948189-15948328,15948535-15948693,15948775-15948878, 15950373-15950548,15952643-15952832,15953704-15953803, 15954171-15954339,15954908-15954990,15955073-15955149, 15955386-15955557 Length = 544 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +3 Query: 93 KDLPKVATDLKSQLEGFNTSCLRDVDTNEKI 185 K+L + DLKS+LEG+NT D++ + + Sbjct: 88 KELDERMHDLKSELEGYNTGDSDDINKKKAL 118 >01_06_0241 - 27813076-27813622,27813695-27814125 Length = 325 Score = 27.9 bits (59), Expect = 9.1 Identities = 13/56 (23%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Frame = +1 Query: 262 EPAEAHRDSGEEPASGQRCYRSGEGKEQIPERHRELRS-H*AEAHGNVREEPAPHK 426 EP H + ++ R +R+ ++ + HR RS H A + V + H+ Sbjct: 23 EPEANHESANQQSHHSNRSHRTASRNAEVEQPHRSNRSHHTASRNAEVEQSHCSHR 78 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,809,203 Number of Sequences: 37544 Number of extensions: 439998 Number of successful extensions: 1294 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1244 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1293 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1980691104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -