BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1414 (761 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 24 4.5 AY748848-1|AAV28194.1| 148|Anopheles gambiae cytochrome P450 pr... 23 7.8 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 662 CVTVLIGAYLISTG 703 CV LIGAYLI G Sbjct: 1876 CVEALIGAYLIECG 1889 >AY748848-1|AAV28194.1| 148|Anopheles gambiae cytochrome P450 protein. Length = 148 Score = 23.4 bits (48), Expect = 7.8 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = -2 Query: 358 FSIFAFIVSCTRTSATVL*SLLKRILDSEISFSATIMRLFVYCS 227 F I A V ATVL L + LD+E F +R CS Sbjct: 2 FRILADFVEVFNKQATVLVEKLAKELDNEAGFDC--VRYITLCS 43 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 679,075 Number of Sequences: 2352 Number of extensions: 12076 Number of successful extensions: 26 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -