BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1413 (700 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 24 4.0 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 24 5.3 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 23 9.2 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 23 9.2 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 23 9.2 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 23 9.2 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 23 9.2 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 23 9.2 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 23 9.2 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 23 9.2 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 23 9.2 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 23 9.2 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 23 9.2 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 23 9.2 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 24.2 bits (50), Expect = 4.0 Identities = 16/57 (28%), Positives = 25/57 (43%) Frame = -1 Query: 373 VLKFNHIFSMF*FNYCLKLSIMDIPLRFTLCPVVCD*TDYFSWVLQFKRVIIPLRRT 203 V+ F+H S FNY L S + L ++ D ++ LQ V++ RT Sbjct: 746 VISFSHSLSPISFNYTLSNSSLSRVLSIRDLGIILD--SRLNFKLQLDEVLLKANRT 800 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.8 bits (49), Expect = 5.3 Identities = 14/42 (33%), Positives = 18/42 (42%) Frame = -1 Query: 655 LLNIMHSGFFGLIRVRVEMFFGHCHXQTIFQLLNFVLVYSQE 530 LL + G L+ VE F GHC Q L F L + + Sbjct: 303 LLTVTCRGQIVLVSPSVEQFLGHCQTDLYGQNL-FTLTHPDD 343 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 23.0 bits (47), Expect = 9.2 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 615 RINPKKPECIIFKSTLN 665 +I P+K EC++ ST N Sbjct: 762 QIAPEKTECVLISSTKN 778 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.0 bits (47), Expect = 9.2 Identities = 11/37 (29%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +2 Query: 302 DVHNGEFKAIIELKHGENVI-ELEYTEQQRRKFILDY 409 D H G+ K+ E +HG+ V + + + I+DY Sbjct: 100 DEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDY 136 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 23.0 bits (47), Expect = 9.2 Identities = 11/37 (29%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +2 Query: 302 DVHNGEFKAIIELKHGENVI-ELEYTEQQRRKFILDY 409 D H G+ K+ E +HG+ V + + + I+DY Sbjct: 92 DEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDY 128 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 9.2 Identities = 11/37 (29%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +2 Query: 302 DVHNGEFKAIIELKHGENVI-ELEYTEQQRRKFILDY 409 D H G+ K+ E +HG+ V + + + I+DY Sbjct: 92 DEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDY 128 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.0 bits (47), Expect = 9.2 Identities = 11/37 (29%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +2 Query: 302 DVHNGEFKAIIELKHGENVI-ELEYTEQQRRKFILDY 409 D H G+ K+ E +HG+ V + + + I+DY Sbjct: 92 DEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDY 128 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 9.2 Identities = 11/37 (29%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +2 Query: 302 DVHNGEFKAIIELKHGENVI-ELEYTEQQRRKFILDY 409 D H G+ K+ E +HG+ V + + + I+DY Sbjct: 92 DEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDY 128 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.0 bits (47), Expect = 9.2 Identities = 11/37 (29%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +2 Query: 302 DVHNGEFKAIIELKHGENVI-ELEYTEQQRRKFILDY 409 D H G+ K+ E +HG+ V + + + I+DY Sbjct: 100 DEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDY 136 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 23.0 bits (47), Expect = 9.2 Identities = 11/37 (29%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +2 Query: 302 DVHNGEFKAIIELKHGENVI-ELEYTEQQRRKFILDY 409 D H G+ K+ E +HG+ V + + + I+DY Sbjct: 124 DEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDY 160 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 9.2 Identities = 11/37 (29%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +2 Query: 302 DVHNGEFKAIIELKHGENVI-ELEYTEQQRRKFILDY 409 D H G+ K+ E +HG+ V + + + I+DY Sbjct: 92 DEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDY 128 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.0 bits (47), Expect = 9.2 Identities = 11/37 (29%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +2 Query: 302 DVHNGEFKAIIELKHGENVI-ELEYTEQQRRKFILDY 409 D H G+ K+ E +HG+ V + + + I+DY Sbjct: 100 DEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDY 136 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.0 bits (47), Expect = 9.2 Identities = 11/37 (29%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +2 Query: 302 DVHNGEFKAIIELKHGENVI-ELEYTEQQRRKFILDY 409 D H G+ K+ E +HG+ V + + + I+DY Sbjct: 92 DEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDY 128 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 23.0 bits (47), Expect = 9.2 Identities = 11/37 (29%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +2 Query: 302 DVHNGEFKAIIELKHGENVI-ELEYTEQQRRKFILDY 409 D H G+ K+ E +HG+ V + + + I+DY Sbjct: 100 DEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDY 136 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 781,095 Number of Sequences: 2352 Number of extensions: 16231 Number of successful extensions: 37 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -