BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1413 (700 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE006465-11|AAK61265.1| 436|Homo sapiens unknown protein. 33 1.3 M95712-1|AAA35609.2| 766|Homo sapiens B-raf protein protein. 31 5.2 BC112079-1|AAI12080.1| 766|Homo sapiens v-raf murine sarcoma vi... 31 5.2 BC101757-1|AAI01758.1| 766|Homo sapiens v-raf murine sarcoma vi... 31 5.2 AC006344-3|AAD43193.1| 651|Homo sapiens WUGSC:H_DJ0726N20.3 pro... 31 5.2 >AE006465-11|AAK61265.1| 436|Homo sapiens unknown protein. Length = 436 Score = 32.7 bits (71), Expect = 1.3 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 41 TARTHSPPAAPALCATHEQH 100 TARTH PP APALC H Sbjct: 151 TARTHGPPGAPALCPAVPPH 170 >M95712-1|AAA35609.2| 766|Homo sapiens B-raf protein protein. Length = 766 Score = 30.7 bits (66), Expect = 5.2 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 1/72 (1%) Frame = -3 Query: 350 LHV-LIQLLP*TLHYGHPIAFYFVSRCL*LNRLLFLGITV*TCYYSFKKNNRIVNAVSIL 174 LHV +++ +P T H F+ ++ C +LLF G TC Y F + R V ++ Sbjct: 222 LHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKF--HQRCSTEVPLM 279 Query: 173 KVCYENR*VLFV 138 V Y+ +LFV Sbjct: 280 CVNYDQLDLLFV 291 >BC112079-1|AAI12080.1| 766|Homo sapiens v-raf murine sarcoma viral oncogene homolog B1 protein. Length = 766 Score = 30.7 bits (66), Expect = 5.2 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 1/72 (1%) Frame = -3 Query: 350 LHV-LIQLLP*TLHYGHPIAFYFVSRCL*LNRLLFLGITV*TCYYSFKKNNRIVNAVSIL 174 LHV +++ +P T H F+ ++ C +LLF G TC Y F + R V ++ Sbjct: 222 LHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKF--HQRCSTEVPLM 279 Query: 173 KVCYENR*VLFV 138 V Y+ +LFV Sbjct: 280 CVNYDQLDLLFV 291 >BC101757-1|AAI01758.1| 766|Homo sapiens v-raf murine sarcoma viral oncogene homolog B1 protein. Length = 766 Score = 30.7 bits (66), Expect = 5.2 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 1/72 (1%) Frame = -3 Query: 350 LHV-LIQLLP*TLHYGHPIAFYFVSRCL*LNRLLFLGITV*TCYYSFKKNNRIVNAVSIL 174 LHV +++ +P T H F+ ++ C +LLF G TC Y F + R V ++ Sbjct: 222 LHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKF--HQRCSTEVPLM 279 Query: 173 KVCYENR*VLFV 138 V Y+ +LFV Sbjct: 280 CVNYDQLDLLFV 291 >AC006344-3|AAD43193.1| 651|Homo sapiens WUGSC:H_DJ0726N20.3 protein. Length = 651 Score = 30.7 bits (66), Expect = 5.2 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 1/72 (1%) Frame = -3 Query: 350 LHV-LIQLLP*TLHYGHPIAFYFVSRCL*LNRLLFLGITV*TCYYSFKKNNRIVNAVSIL 174 LHV +++ +P T H F+ ++ C +LLF G TC Y F + R V ++ Sbjct: 67 LHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKF--HQRCSTEVPLM 124 Query: 173 KVCYENR*VLFV 138 V Y+ +LFV Sbjct: 125 CVNYDQLDLLFV 136 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,206,105 Number of Sequences: 237096 Number of extensions: 2176547 Number of successful extensions: 4416 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4416 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8063224416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -