BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1411 (807 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1406 + 26343915-26346032 30 1.9 01_01_0180 + 1533219-1533536,1533658-1533825,1535404-1535475,153... 28 7.6 >07_03_1406 + 26343915-26346032 Length = 705 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 10 RPSEPKPTSPARGAPCRPTNEALARRGRH 96 RP P SPA + C P A ARRG H Sbjct: 19 RPRLPPLASPATTSTCAPAPAATARRGSH 47 >01_01_0180 + 1533219-1533536,1533658-1533825,1535404-1535475, 1536174-1536179,1536228-1536440,1537434-1537700, 1537947-1538267 Length = 454 Score = 28.3 bits (60), Expect = 7.6 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 7 PRPSEPKPTSPARGAPCRPTNEALARRGRHGTTVAYIVDDSGSDH 141 P P E +P+SP+ C + RRG + VA + D + DH Sbjct: 6 PPPPEEEPSSPSLRLRCAVQHYEWGRRG-EASLVARLSDANADDH 49 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,767,257 Number of Sequences: 37544 Number of extensions: 349955 Number of successful extensions: 1065 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1004 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1062 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2197677108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -