BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1410 (835 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 22 5.2 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 22 5.2 AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 22 5.2 U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 22 6.9 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 22 6.9 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 22.2 bits (45), Expect = 5.2 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = +2 Query: 92 TSPRSPQT*RVSSKASTPAVSVTSTPMKRLCFRLLKTSPLRRPRSLYS-TVSRS 250 ++PRS SS + S S+ ++ RLL +P+ YS T+ S Sbjct: 152 STPRSSPAETASSLSPQSVASTASSADHQIVDRLLSHAPIDSANQWYSQTIDNS 205 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 22.2 bits (45), Expect = 5.2 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = +2 Query: 92 TSPRSPQT*RVSSKASTPAVSVTSTPMKRLCFRLLKTSPLRRPRSLYS-TVSRS 250 ++PRS SS + S S+ ++ RLL +P+ YS T+ S Sbjct: 143 STPRSSPAETASSLSPQSVASTASSADHQIVDRLLSHAPIDSANQWYSQTIDNS 196 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 22.2 bits (45), Expect = 5.2 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +2 Query: 368 SH*AEAHGNVREEPAPHKGRH*AREISLNHYFITVT 475 +H E + +V+EEP R + LNH+ +VT Sbjct: 40 THNNEMYHSVKEEPIYESCRFSINQPYLNHFDNSVT 75 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 21.8 bits (44), Expect = 6.9 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +2 Query: 368 SH*AEAHGNVREEPAPHKGRH*AREISLNHYFITVT 475 +H E + V+EEP R + LNH+ +VT Sbjct: 40 THNNEMYHRVKEEPIYESCRFSINQPYLNHFDNSVT 75 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 21.8 bits (44), Expect = 6.9 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +2 Query: 368 SH*AEAHGNVREEPAPHKGRH*AREISLNHYFITVT 475 +H E + V+EEP R + LNH+ +VT Sbjct: 40 THNNEMYHRVKEEPIYESCRFSINQPYLNHFDNSVT 75 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,663 Number of Sequences: 336 Number of extensions: 4170 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22932949 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -