BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1410 (835 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1577 - 27869596-27869682,27869769-27869869,27869956-278699... 30 2.6 09_02_0479 - 9753161-9753171,9755260-9755547,9755883-9756222 29 4.6 01_06_0241 - 27813076-27813622,27813695-27814125 29 4.6 01_01_0829 + 6471032-6471870,6472490-6472685,6472772-6472956,647... 29 4.6 06_03_0165 - 17399535-17400178,17400378-17400522 29 6.0 10_06_0110 + 10889414-10889669,10889756-10889806,10890595-108911... 28 8.0 09_04_0276 - 16306894-16307526,16307556-16308572 28 8.0 >07_03_1577 - 27869596-27869682,27869769-27869869,27869956-27869995, 27870879-27870953 Length = 100 Score = 29.9 bits (64), Expect = 2.6 Identities = 10/25 (40%), Positives = 19/25 (76%) Frame = +1 Query: 112 DLKSQLEGFNTSCLRDVDTNEKIVL 186 DL+S+L+ NT CL + + N+K+++ Sbjct: 54 DLQSKLDAVNTECLAEKEKNKKLII 78 >09_02_0479 - 9753161-9753171,9755260-9755547,9755883-9756222 Length = 212 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/24 (45%), Positives = 19/24 (79%) Frame = +2 Query: 119 RVSSKASTPAVSVTSTPMKRLCFR 190 +VSS++S+P SVT+ ++ +CFR Sbjct: 72 QVSSQSSSPVESVTTATLRPICFR 95 >01_06_0241 - 27813076-27813622,27813695-27814125 Length = 325 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/57 (22%), Positives = 25/57 (43%), Gaps = 1/57 (1%) Frame = +2 Query: 254 IEPAEAHRDSGEEPASGQRCYRSGEGKEQIPERHRELRS-H*AEAHGNVREEPAPHK 421 +EP H + ++ R +R+ ++ + HR RS H A + V + H+ Sbjct: 22 VEPEANHESANQQSHHSNRSHRTASRNAEVEQPHRSNRSHHTASRNAEVEQSHCSHR 78 >01_01_0829 + 6471032-6471870,6472490-6472685,6472772-6472956, 6473206-6473539,6473629-6473833,6474927-6475033, 6475117-6475269 Length = 672 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +2 Query: 74 TLPP*KTSPRSPQT*RVSSKASTPAVSVTST 166 TLPP + SP SP T SSK TP+ S S+ Sbjct: 31 TLPPGRLSPVSPLTHSSSSKLPTPSSSSGSS 61 >06_03_0165 - 17399535-17400178,17400378-17400522 Length = 262 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +1 Query: 568 YNGNTAWAMATYSNPGFYSNPNDKSRLTPINSEWTP 675 ++G W T G YS D +RLT I SE P Sbjct: 221 FSGEYRWCYPTPVREGIYSLATDANRLTTIFSEENP 256 >10_06_0110 + 10889414-10889669,10889756-10889806,10890595-10891163, 10891178-10891660,10891747-10891944,10893300-10893354, 10893372-10893631 Length = 623 Score = 28.3 bits (60), Expect = 8.0 Identities = 22/73 (30%), Positives = 30/73 (41%), Gaps = 4/73 (5%) Frame = +2 Query: 95 SPRSPQT*RVSSKASTPAVSVTSTPMKRLCFRLLKTSPL----RRPRSLYSTVSRSLIEP 262 SP + SS P +++ + P R + PL R R + V+R IEP Sbjct: 10 SPEANTLSPTSSPLPLPPITIHAPPFTRALHHAASSFPLLSQHRSHRWKGAAVARIGIEP 69 Query: 263 AEAHRDSGEEPAS 301 A R EEP S Sbjct: 70 AMGRRQQPEEPDS 82 >09_04_0276 - 16306894-16307526,16307556-16308572 Length = 549 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -2 Query: 705 YTNYLY*IGLWRPLAVYWRKAR 640 +T Y Y LW P YWR+AR Sbjct: 111 HTTYNYTDILWSPYGAYWRQAR 132 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,065,312 Number of Sequences: 37544 Number of extensions: 463928 Number of successful extensions: 1335 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1288 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1334 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2303447664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -