BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1410 (835 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 29 0.053 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 2.6 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 4.6 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 22 8.0 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 29.1 bits (62), Expect = 0.053 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +2 Query: 209 LRRPRSLYSTVSRSLIEPAEAHRDSGEEPASGQR 310 LRR R L +TV+R+ + H DSG ++ QR Sbjct: 248 LRRSRMLTATVNRNHLSGGTNHWDSGRRKSAAQR 281 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 23.4 bits (48), Expect = 2.6 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 64 SVSDTPSLKDLPKVATDLKS 123 SVS PS+K + K ATD S Sbjct: 156 SVSCVPSVKHVAKCATDFSS 175 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.6 bits (46), Expect = 4.6 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +2 Query: 560 CFCTMATLPGQWRRTATPDFIQIL 631 C C+M LPG +T+T ++ +I+ Sbjct: 684 CNCSMDWLPGINNQTSTREYPRIM 707 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 21.8 bits (44), Expect = 8.0 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 534 QIDLTYINIKYGDTSEI 484 QIDL +IN GD EI Sbjct: 172 QIDLKHINQNMGDKVEI 188 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 223,376 Number of Sequences: 438 Number of extensions: 5268 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26702940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -