BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1409 (733 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC895.08c |||conserved fungal protein|Schizosaccharomyces pomb... 29 0.68 SPBC56F2.09c |arg5||arginine specific carbamoyl-phosphate syntha... 26 4.8 SPCP1E11.03 |mug170||arrestin|Schizosaccharomyces pombe|chr 3|||... 26 6.4 SPBC20F10.04c |nse4|rad62|Smc5-6 complex non-SMC subunit Nse4|Sc... 26 6.4 >SPCC895.08c |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 490 Score = 29.1 bits (62), Expect = 0.68 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = -1 Query: 592 TPSCSGAASLPLARHFPGQCSL**VGMSLGSNKKIKIDFINSFSIL-EMHRC 440 T S +G P R P +C + LG+N K+K +F I+ + RC Sbjct: 46 TASFTGLKKFPTERQLPLECHFNHIDWDLGNNFKVKEGVFYTFDIIAPLPRC 97 >SPBC56F2.09c |arg5||arginine specific carbamoyl-phosphate synthase Arg5 |Schizosaccharomyces pombe|chr 2|||Manual Length = 415 Score = 26.2 bits (55), Expect = 4.8 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +1 Query: 379 RYLSPFPIQFCKVYFSK 429 R+L PFP++F K ++SK Sbjct: 3 RFLKPFPLRFGKRFYSK 19 >SPCP1E11.03 |mug170||arrestin|Schizosaccharomyces pombe|chr 3|||Manual Length = 426 Score = 25.8 bits (54), Expect = 6.4 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 493 SCCFLNSYRPIKESTDLESVWQEEERPPQNNLA 591 SC +L Y+ K T +S W+ + +NLA Sbjct: 336 SCGYLKRYQKTKTKTRAKSTWKIANKSVYSNLA 368 >SPBC20F10.04c |nse4|rad62|Smc5-6 complex non-SMC subunit Nse4|Schizosaccharomyces pombe|chr 2|||Manual Length = 300 Score = 25.8 bits (54), Expect = 6.4 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -3 Query: 575 GGLSSSCQTLSRSVLSLIGRYEFRKQQEN*NR 480 G L+S+C+ S+ ++G FRK++ N R Sbjct: 119 GKLASNCEKQPASLNLMVGPLSFRKKERNIQR 150 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,513,050 Number of Sequences: 5004 Number of extensions: 44469 Number of successful extensions: 121 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 121 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 345237368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -