BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1409 (733 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 7.4 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 7.4 AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol ... 23 7.4 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.4 bits (48), Expect = 7.4 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +1 Query: 517 RPIKESTDLESVWQE 561 RP+K+ DLE+ W + Sbjct: 162 RPLKKQLDLEAAWMQ 176 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.4 bits (48), Expect = 7.4 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +1 Query: 580 NNLASLGRAGARDLGRDVGGTRTDCQRPI*LEKINSSPTPQQRV 711 N ++ GR + D GRD G D + ++ SSP P +++ Sbjct: 281 NIISDGGRIRSGDGGRDSRGGGVDAAKKQHQQQQRSSPQPPEKM 324 >AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol kinase protein. Length = 555 Score = 23.4 bits (48), Expect = 7.4 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = -1 Query: 250 IYRIILWSDIKTKQTL 203 +Y I+W+DI+T +T+ Sbjct: 105 LYNAIVWNDIRTDKTV 120 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 599,388 Number of Sequences: 2352 Number of extensions: 10074 Number of successful extensions: 60 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -