BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1408 (751 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL031627-13|CAA20964.1| 304|Caenorhabditis elegans Hypothetical... 32 0.50 CU457741-7|CAM36348.1| 710|Caenorhabditis elegans Hypothetical ... 31 0.87 Z68315-4|CAA92675.2| 745|Caenorhabditis elegans Hypothetical pr... 28 6.2 AL031632-1|CAA21004.1| 248|Caenorhabditis elegans Hypothetical ... 28 6.2 >AL031627-13|CAA20964.1| 304|Caenorhabditis elegans Hypothetical protein Y102A5C.23 protein. Length = 304 Score = 31.9 bits (69), Expect = 0.50 Identities = 21/101 (20%), Positives = 48/101 (47%) Frame = -1 Query: 472 IITKKITCVQFTRGRSETFQN*NTIILNVLSICKILSLVNNCKVAPSVN*YFNFTYNPEL 293 IITK+++C+ + E Q I ++ LS + + S+ Y N + Sbjct: 141 IITKEVSCLLYASWDYEPVQFQYWITCSINDALVFLSAILYIPIVISIRKYANLRWAQRS 200 Query: 292 KFTTRAFIHTLVLKISQMALY*IVCIFLSHSLLASSYTFLY 170 + F+ T+V+ ++ ++ +VC+ +H+ ++ + F+Y Sbjct: 201 QPHKYIFLQTMVV-LTFKSIQVLVCLMTNHNGISLTSLFIY 240 >CU457741-7|CAM36348.1| 710|Caenorhabditis elegans Hypothetical protein C42C1.7 protein. Length = 710 Score = 31.1 bits (67), Expect = 0.87 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = -1 Query: 307 YNPELKFTTRAFIHTLVLKISQMALY*IVCIFLSHSLLASSYTFLYLCLLPVV 149 Y +L F HT L + + + IFL +L +S + F Y CLL V+ Sbjct: 128 YFEKLSLAMDIFTHTWSLSVEIQFYFVVPFIFLIGNLFSSVFKFGYYCLLGVI 180 >Z68315-4|CAA92675.2| 745|Caenorhabditis elegans Hypothetical protein F28C6.4a protein. Length = 745 Score = 28.3 bits (60), Expect = 6.2 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +2 Query: 404 ILILEGFTSTSCELHTCNFFSYNASS--KSLFCRLIL*RHNFVHRLHS 541 IL L G ++SC + FSY SS SL C I H F+ ++S Sbjct: 679 ILFLCGCNASSCTSLLNHLFSYRISSMCTSLICLYIFQNHLFIWSVYS 726 >AL031632-1|CAA21004.1| 248|Caenorhabditis elegans Hypothetical protein Y32B12B.1 protein. Length = 248 Score = 28.3 bits (60), Expect = 6.2 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 Query: 583 VYPYRICNCLCVY 545 +Y Y+ C CLCVY Sbjct: 9 IYSYKFCRCLCVY 21 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,937,486 Number of Sequences: 27780 Number of extensions: 361047 Number of successful extensions: 938 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 919 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 938 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1777507862 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -