BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1407 (791 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q553C2 Cluster: Putative uncharacterized protein; n=2; ... 34 3.6 UniRef50_Q25802 Cluster: RpoD protein; n=2; Plasmodium|Rep: RpoD... 34 4.7 UniRef50_Q8IBH6 Cluster: Putative uncharacterized protein PF07_0... 33 6.2 UniRef50_A0BIM4 Cluster: Chromosome undetermined scaffold_11, wh... 33 8.2 >UniRef50_Q553C2 Cluster: Putative uncharacterized protein; n=2; Dictyostelium discoideum|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 334 Score = 34.3 bits (75), Expect = 3.6 Identities = 19/51 (37%), Positives = 29/51 (56%) Frame = +3 Query: 537 LTP*HLELLLTYLSNKKIKVNHATDVLGVYIDHNYLAVLTYIGLSYLPLQA 689 L+P H +L+ + K +K+ +D+L Y D NY V+T G+ Y LQA Sbjct: 123 LSPQHKQLIRLPKNFKDVKL--LSDILSQYTDDNYFIVITTFGVIYTFLQA 171 >UniRef50_Q25802 Cluster: RpoD protein; n=2; Plasmodium|Rep: RpoD protein - Plasmodium falciparum Length = 960 Score = 33.9 bits (74), Expect = 4.7 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 2/80 (2%) Frame = -1 Query: 551 VLRG*ANMQQLNNSCFYSNKYCFRFYI--IFSYLDIIPLTL*KDHFHLNDKFN*NYLKLK 378 +L+ N+Q LN + +N + + Y +F YL+II + K + + K+ N L Sbjct: 529 ILKNFNNIQILNKLFYVNNIFIYYKYEKKLFIYLNIINNIIIKKYLNFY-KYTYNKLFFI 587 Query: 377 TNYTN*ILSFEIFKKNIY*Y 318 Y N + +EIFK N Y Y Sbjct: 588 KKYNNFLYLYEIFKYNWYKY 607 >UniRef50_Q8IBH6 Cluster: Putative uncharacterized protein PF07_0118; n=3; Plasmodium|Rep: Putative uncharacterized protein PF07_0118 - Plasmodium falciparum (isolate 3D7) Length = 5561 Score = 33.5 bits (73), Expect = 6.2 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 3/77 (3%) Frame = -1 Query: 533 NMQQLNNSCFYSNKYCFRFYIIFSYLDII---PLTL*KDHFHLNDKFN*NYLKLKTNYTN 363 N NN+ Y+N Y + + SYL + ++L K + L D FN ++ N+ N Sbjct: 1651 NNNNNNNNNIYNNNYYYDNNLFLSYLHLYEKNSISLYKKNLKLFDNFNLTHI----NFIN 1706 Query: 362 *ILSFEIFKKNIY*YNI 312 + +F IF +NIY N+ Sbjct: 1707 VLFNF-IFYENIYLINL 1722 >UniRef50_A0BIM4 Cluster: Chromosome undetermined scaffold_11, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_11, whole genome shotgun sequence - Paramecium tetraurelia Length = 169 Score = 33.1 bits (72), Expect = 8.2 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = +3 Query: 12 ETNNHSSKEAAK*LLRNCPNAVHNIHTGKSKCFQ 113 +TNN SK+ + L+R C N + +I TG+ K F+ Sbjct: 65 DTNNFFSKQRKRRLMRKCQNIIIDIATGEIKLFE 98 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 635,762,380 Number of Sequences: 1657284 Number of extensions: 11413942 Number of successful extensions: 20866 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 20155 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20863 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 67496806780 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -