BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1407 (791 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_1337 - 35780076-35780290,35780377-35780408,35780490-357805... 32 0.45 >02_05_1337 - 35780076-35780290,35780377-35780408,35780490-35780584, 35780670-35780743,35780851-35780986,35781072-35781135, 35781333-35781395,35781514-35781656,35781752-35781889, 35781973-35782094,35782210-35782375,35782647-35782652, 35782988-35783059,35783241-35783348,35783719-35783848, 35783964-35784070,35784896-35785005,35785302-35785435, 35785528-35785982,35786068-35786595 Length = 965 Score = 32.3 bits (70), Expect = 0.45 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +3 Query: 585 KIKVNHATDVLGVYIDHNYLAVLTYIGLSYLPLQ--AHNKYANPNFVK 722 K V + + G I H YL LT L+YLP++ HN Y + + K Sbjct: 455 KSVVQYFQETYGFAIQHTYLPCLTVQRLNYLPMEMVKHNAYQDDPYAK 502 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,693,162 Number of Sequences: 37544 Number of extensions: 262542 Number of successful extensions: 427 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 427 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2138915688 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -