BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1405X (488 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_02_0136 + 12195422-12195435,12196047-12196122,12196896-121977... 40 0.001 12_02_0008 + 12239759-12239923,12240404-12240443,12241278-122414... 38 0.006 02_05_1041 - 33713561-33714564,33714844-33714904,33715640-337159... 36 0.013 11_04_0274 - 15667178-15667444,15668352-15668678,15669430-156695... 35 0.030 02_05_0300 + 27681204-27681656,27681745-27681840,27681933-276820... 35 0.040 08_01_0244 + 2016548-2017101,2017392-2019681,2019785-2019817 33 0.093 06_03_0867 + 25534760-25539620,25540662-25540857,25540957-255411... 33 0.093 01_06_1254 + 35761046-35761162,35761332-35761416,35761877-357620... 33 0.093 06_03_1309 + 29223197-29223240,29223358-29223592,29223695-292237... 33 0.12 03_01_0085 + 690618-691012,691114-691193,691775-691959,692363-69... 33 0.12 01_01_1096 - 8659091-8659459,8660730-8661050,8661416-8661694,866... 33 0.12 01_06_1805 - 39999987-40000169,40000648-40000974,40001724-400020... 33 0.16 10_07_0063 - 12502305-12503361,12503567-12503668,12504251-125043... 32 0.28 08_01_0181 + 1530623-1531626,1531723-1531902,1531998-1532177,153... 32 0.28 06_03_1121 + 27767707-27768065,27768612-27769034,27770013-277701... 31 0.38 02_02_0568 + 11577804-11578676,11578956-11579042,11579043-11579141 31 0.50 01_01_1092 - 8593414-8593776,8597750-8597931,8598080-8598152 31 0.50 01_05_0707 - 24468329-24468448,24468794-24468940,24469050-244691... 31 0.66 07_03_1709 - 28873172-28873327,28873519-28873584,28874067-288741... 30 0.87 03_02_0874 + 12017069-12018051,12018137-12018316,12018421-120186... 30 1.1 06_03_0253 + 18753901-18754278,18754873-18754968,18755167-187553... 29 1.5 06_03_0246 + 18672704-18673111,18674069-18674164,18674362-186745... 29 1.5 03_06_0523 + 34499533-34499705,34499808-34499917,34500037-345002... 29 1.5 03_02_0875 + 12038365-12039329,12039417-12039593,12039651-120398... 29 1.5 05_05_0351 - 24319356-24319385,24319470-24320902,24321011-243211... 29 2.6 03_02_0709 + 10583621-10583626,10583711-10584712,10585304-10585669 29 2.6 01_05_0420 + 21969797-21970939,21971307-21971369,21971488-219716... 29 2.6 07_03_1050 - 23570785-23570824,23570938-23571004,23571114-235711... 28 3.5 01_01_1089 - 8560008-8560220,8560456-8560977,8561095-8561283,856... 28 3.5 08_01_0395 - 3502750-3503033,3504844-3505663 28 4.6 02_05_1332 + 35758657-35758728,35758959-35760689 28 4.6 07_01_0281 - 2067696-2068862 27 6.1 06_03_0766 - 24425486-24426245,24430766-24430855,24430951-244310... 27 6.1 05_03_0188 + 9417186-9417306,9417418-9417604,9417669-9417801,941... 27 6.1 09_06_0048 + 20477076-20478547,20478643-20478722,20478880-204788... 27 8.1 02_01_0703 + 5251901-5251950,5252783-5253554 27 8.1 02_01_0278 - 1851338-1851412,1851579-1851819,1851946-1852047,185... 27 8.1 >06_02_0136 + 12195422-12195435,12196047-12196122,12196896-12197707, 12197941-12198010,12199469-12199557,12199633-12199666 Length = 364 Score = 39.5 bits (88), Expect = 0.001 Identities = 19/51 (37%), Positives = 27/51 (52%) Frame = +1 Query: 43 LHIIIE*NYPIMIVCKFFQQGYCRYGQNCRFEHVYGSKYTYHATTPQPVVT 195 LHI++ + VC F+Q+G C YG CR++HV S+ A P T Sbjct: 21 LHILV---LRTLQVCTFYQKGSCSYGSRCRYDHVKVSRNPTVAPPPSSSTT 68 >12_02_0008 + 12239759-12239923,12240404-12240443,12241278-12241435, 12242400-12242462,12243149-12243268,12243388-12243684, 12245012-12245335,12246411-12246680 Length = 478 Score = 37.5 bits (83), Expect = 0.006 Identities = 15/43 (34%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = +1 Query: 82 VCKFFQQ-GYCRYGQNCRFEHVYGSKYTYHATTPQPVVTNTEH 207 VC F+ + G C++G NC+F+H G+ AT+P+ V++ + Sbjct: 393 VCTFYSRYGICKFGPNCKFDHPMGTLMYGSATSPRGDVSSMHY 435 Score = 27.5 bits (58), Expect = 6.1 Identities = 8/20 (40%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +1 Query: 85 CKFFQQ-GYCRYGQNCRFEH 141 C ++ + G CR+G C+F H Sbjct: 96 CSYYMRTGLCRFGMTCKFNH 115 >02_05_1041 - 33713561-33714564,33714844-33714904,33715640-33715951, 33716780-33716917 Length = 504 Score = 36.3 bits (80), Expect = 0.013 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +1 Query: 76 MIVCKFFQQGYCRYGQNCRFEH 141 M +CKFF Q CR+G NCR H Sbjct: 149 MSMCKFFLQQRCRFGSNCRLSH 170 >11_04_0274 - 15667178-15667444,15668352-15668678,15669430-15669563, 15669669-15669726,15669842-15669961,15670814-15670876, 15671388-15671539,15673002-15673116,15673907-15673981, 15674474-15674538,15675020-15675128 Length = 494 Score = 35.1 bits (77), Expect = 0.030 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = +1 Query: 82 VCKFFQQ-GYCRYGQNCRFEHVYGSKYTYHATTP 180 +C F+ + G C++G NC+F+H G+ AT+P Sbjct: 410 ICTFYSRYGICKFGPNCKFDHPMGTVMYGLATSP 443 Score = 27.5 bits (58), Expect = 6.1 Identities = 8/20 (40%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +1 Query: 85 CKFFQQ-GYCRYGQNCRFEH 141 C ++ + G CR+G C+F H Sbjct: 147 CSYYMRTGLCRFGMTCKFNH 166 >02_05_0300 + 27681204-27681656,27681745-27681840,27681933-27682022, 27682126-27682227,27682310-27682456,27683608-27683748, 27683749-27683808,27685133-27685230,27685308-27685410, 27685954-27686037 Length = 457 Score = 34.7 bits (76), Expect = 0.040 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 85 CKFFQQGYCRYGQNCRFEHVYGSKYTYHATTP 180 C++F G C YG+ CR+ H Y + TP Sbjct: 114 CRYFLAGDCSYGEKCRYPHSYSMSDSITMLTP 145 >08_01_0244 + 2016548-2017101,2017392-2019681,2019785-2019817 Length = 958 Score = 33.5 bits (73), Expect = 0.093 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +1 Query: 85 CKFFQQGYCRYGQNCRFEHVYGSK 156 CKFF G CR GQNC + H S+ Sbjct: 379 CKFFANGGCRRGQNCPYLHEEASQ 402 Score = 31.5 bits (68), Expect = 0.38 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +1 Query: 85 CKFFQQGYCRYGQNCRFEHVYGSKYTYHATTP 180 C+ F G CR G NCRF H G + + P Sbjct: 235 CRDFVAGRCRRGSNCRFPHEDGVRRQFDEHYP 266 >06_03_0867 + 25534760-25539620,25540662-25540857,25540957-25541104, 25541673-25541751,25542151-25542238,25542330-25542600, 25542676-25542718,25542801-25542904,25543374-25543790 Length = 2068 Score = 33.5 bits (73), Expect = 0.093 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +1 Query: 46 HIIIE*NYPIMIVCKFFQQGYCRYGQNCRFEHVY 147 H+ + N P VC+ F +GYC YG C +H Y Sbjct: 1907 HVKVNLNAP---VCEDFLKGYCAYGDECHKKHSY 1937 >01_06_1254 + 35761046-35761162,35761332-35761416,35761877-35762017, 35762118-35762206,35762519-35762701,35763509-35763697, 35763808-35763938,35764023-35764125,35765123-35765308 Length = 407 Score = 33.5 bits (73), Expect = 0.093 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 70 PIMIVCKFFQQGYCRYGQNCRFEH 141 P IVC+FF+ G C+ G C+F H Sbjct: 71 PKSIVCEFFKVGQCQKGFKCKFSH 94 >06_03_1309 + 29223197-29223240,29223358-29223592,29223695-29223783, 29223870-29223968,29224065-29224158,29224297-29224514, 29224861-29224967,29225298-29225472,29225596-29225743, 29226548-29226596,29228016-29228162,29229990-29229996, 29230417-29230482,29230773-29231991,29232073-29233149, 29233226-29233355,29233519-29233617,29233817-29233878, 29234429-29234533 Length = 1389 Score = 33.1 bits (72), Expect = 0.12 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +1 Query: 82 VCKFFQQGYCRYGQNCRFEH 141 +C+ FQ+G C+YG CR+ H Sbjct: 7 ICRNFQRGSCKYGAQCRYLH 26 >03_01_0085 + 690618-691012,691114-691193,691775-691959,692363-693320, 693391-693518,693951-694010,694113-694163,694704-694821, 694990-695915,695916-697707,697810-697943,698029-698526 Length = 1774 Score = 33.1 bits (72), Expect = 0.12 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 82 VCKFFQQGYCRYGQNCRFEH 141 +CKF + GYCR G +C + H Sbjct: 1754 ICKFHENGYCRKGASCNYLH 1773 >01_01_1096 - 8659091-8659459,8660730-8661050,8661416-8661694, 8661781-8661897,8662142-8662210,8663204-8663397, 8663552-8663633 Length = 476 Score = 33.1 bits (72), Expect = 0.12 Identities = 11/24 (45%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = +1 Query: 85 CKFF-QQGYCRYGQNCRFEHVYGS 153 C ++ Q GYCRYG C+++H G+ Sbjct: 359 CAYYAQNGYCRYGVACKYDHPMGT 382 Score = 28.3 bits (60), Expect = 3.5 Identities = 7/21 (33%), Positives = 16/21 (76%), Gaps = 1/21 (4%) Frame = +1 Query: 82 VCKFFQQ-GYCRYGQNCRFEH 141 +C+++ + G C++G NC++ H Sbjct: 113 ICEYYMKTGTCKFGTNCKYHH 133 >01_06_1805 - 39999987-40000169,40000648-40000974,40001724-40002017, 40002112-40002231,40002714-40002776,40003150-40003310, 40003864-40004035 Length = 439 Score = 32.7 bits (71), Expect = 0.16 Identities = 10/21 (47%), Positives = 17/21 (80%), Gaps = 1/21 (4%) Frame = +1 Query: 82 VCKFFQQ-GYCRYGQNCRFEH 141 +CKF+ + G C++G NC+F+H Sbjct: 383 LCKFYSRYGICKFGANCKFDH 403 Score = 28.3 bits (60), Expect = 3.5 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +1 Query: 91 FFQQGYCRYGQNCRFEH 141 + + G CR+G +CRF H Sbjct: 89 YLRTGLCRFGMSCRFNH 105 Score = 27.1 bits (57), Expect = 8.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 91 FFQQGYCRYGQNCRFEH 141 + + G C+YG C+F H Sbjct: 180 YLKTGQCKYGNTCKFHH 196 >10_07_0063 - 12502305-12503361,12503567-12503668,12504251-12504378, 12504653-12504764,12504876-12504927,12505260-12505517, 12505943-12506079,12506296-12506606 Length = 718 Score = 31.9 bits (69), Expect = 0.28 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +1 Query: 97 QQGYCRYGQNCRFEH 141 QQG+C YG+NC+F H Sbjct: 701 QQGWCPYGENCKFMH 715 >08_01_0181 + 1530623-1531626,1531723-1531902,1531998-1532177, 1532363-1532442,1532528-1532701,1533001-1533118, 1533223-1533301 Length = 604 Score = 31.9 bits (69), Expect = 0.28 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 85 CKFFQQGYCRYGQNCRFEH 141 C +F +G C+ GQNC + H Sbjct: 217 CHYFSKGICKNGQNCHYSH 235 >06_03_1121 + 27767707-27768065,27768612-27769034,27770013-27770175, 27770271-27770381,27770895-27770963,27771117-27771203, 27771967-27772752 Length = 665 Score = 31.5 bits (68), Expect = 0.38 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +1 Query: 85 CKFFQQGYCRYGQNCRFEHV 144 C ++ G+C G NCR++HV Sbjct: 118 CNMYKMGFCPNGPNCRYKHV 137 >02_02_0568 + 11577804-11578676,11578956-11579042,11579043-11579141 Length = 352 Score = 31.1 bits (67), Expect = 0.50 Identities = 11/24 (45%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = +1 Query: 82 VCKFFQQ-GYCRYGQNCRFEHVYG 150 +CK +++ GYC YG +C+F H G Sbjct: 192 ICKDYKETGYCGYGDSCKFMHDRG 215 >01_01_1092 - 8593414-8593776,8597750-8597931,8598080-8598152 Length = 205 Score = 31.1 bits (67), Expect = 0.50 Identities = 9/24 (37%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = +1 Query: 85 CKFF-QQGYCRYGQNCRFEHVYGS 153 C ++ Q G+C++G C+F+H G+ Sbjct: 90 CAYYTQHGFCKFGPTCKFDHPMGT 113 Score = 28.7 bits (61), Expect = 2.6 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +1 Query: 91 FFQQGYCRYGQNCRFEHVYGSKYTYHATTPQPVVTNTEH 207 + + G C YG+NCR+ H A QP T+H Sbjct: 60 YLRTGACGYGENCRYNHPRDRAAA--AVGSQPCAYYTQH 96 >01_05_0707 - 24468329-24468448,24468794-24468940,24469050-24469103, 24469185-24469300,24470537-24470583,24470686-24470723, 24471050-24471268,24471504-24471602,24471675-24471728, 24472907-24473148,24474258-24474447 Length = 441 Score = 30.7 bits (66), Expect = 0.66 Identities = 9/22 (40%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = +1 Query: 79 IVCKFFQQ-GYCRYGQNCRFEH 141 +VC F+ + G C++G C+F+H Sbjct: 405 VVCAFYMKTGVCKFGMQCKFDH 426 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/25 (40%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = +1 Query: 70 PIMIVCKFFQQ-GYCRYGQNCRFEH 141 P + C F+ + G C++G CRF H Sbjct: 268 PGEVDCPFYMKMGSCKFGSTCRFNH 292 Score = 28.3 bits (60), Expect = 3.5 Identities = 9/25 (36%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = +1 Query: 70 PIMIVCKFFQQ-GYCRYGQNCRFEH 141 P VC F+ + G+C++ C+F H Sbjct: 347 PGATVCDFYMKTGFCKFADRCKFHH 371 Score = 27.9 bits (59), Expect = 4.6 Identities = 9/20 (45%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +1 Query: 85 CKFFQQ-GYCRYGQNCRFEH 141 C FF + G C++G C+F H Sbjct: 161 CPFFMKTGKCKFGSKCKFNH 180 >07_03_1709 - 28873172-28873327,28873519-28873584,28874067-28874127, 28875406-28875462,28876301-28876531,28876685-28876799, 28876897-28877136,28877222-28877316,28877406-28877585, 28877663-28877839,28877920-28878890 Length = 782 Score = 30.3 bits (65), Expect = 0.87 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 85 CKFFQQGYCRYGQNCRFEH 141 C ++ +GYC+ G CRF H Sbjct: 235 CLYYARGYCKNGSACRFVH 253 >03_02_0874 + 12017069-12018051,12018137-12018316,12018421-12018600, 12018718-12018797,12018999-12019259,12019360-12019474, 12019631-12019855,12020840-12020849 Length = 677 Score = 29.9 bits (64), Expect = 1.1 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +1 Query: 85 CKFFQQGYCRYGQNCRFEH 141 C ++ +G+C+ G +CRF H Sbjct: 239 CLYYARGFCKNGSSCRFVH 257 >06_03_0253 + 18753901-18754278,18754873-18754968,18755167-18755376, 18756028-18756093,18756379-18756576,18756616-18756810, 18756968-18757014,18757147-18757234,18757331-18757681, 18758593-18759123 Length = 719 Score = 29.5 bits (63), Expect = 1.5 Identities = 8/21 (38%), Positives = 16/21 (76%), Gaps = 1/21 (4%) Frame = +1 Query: 82 VCKFFQ-QGYCRYGQNCRFEH 141 +C ++ +G C++G NC+F+H Sbjct: 162 LCSYYMNRGICKFGTNCKFDH 182 Score = 28.7 bits (61), Expect = 2.6 Identities = 9/20 (45%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = +1 Query: 85 CKFFQQ-GYCRYGQNCRFEH 141 C ++ + G C++G NCRF H Sbjct: 96 CSYYVKFGSCKFGMNCRFNH 115 >06_03_0246 + 18672704-18673111,18674069-18674164,18674362-18674571, 18675780-18675851,18675898-18675945 Length = 277 Score = 29.5 bits (63), Expect = 1.5 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 91 FFQQGYCRYGQNCRFEH 141 + + G C+YG NCRF H Sbjct: 110 YLRFGRCKYGMNCRFNH 126 Score = 29.1 bits (62), Expect = 2.0 Identities = 8/21 (38%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = +1 Query: 82 VCKFFQ-QGYCRYGQNCRFEH 141 +C ++ +G C++G NC+F H Sbjct: 172 LCSYYMNRGICKFGSNCKFHH 192 >03_06_0523 + 34499533-34499705,34499808-34499917,34500037-34500224, 34500984-34501451 Length = 312 Score = 29.5 bits (63), Expect = 1.5 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 82 VCKFFQQGYCRYGQNCRFEH 141 VC FQ+G C G +CR+ H Sbjct: 135 VCYAFQKGECNRGASCRYSH 154 >03_02_0875 + 12038365-12039329,12039417-12039593,12039651-12039893, 12040045-12040124,12040242-12040508,12040599-12040710, 12040757-12041071,12041357-12041366 Length = 722 Score = 29.5 bits (63), Expect = 1.5 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +1 Query: 85 CKFFQQGYCRYGQNCRFEH 141 C ++ +G+C+ G CRF H Sbjct: 234 CLYYARGFCKNGSTCRFVH 252 >05_05_0351 - 24319356-24319385,24319470-24320902,24321011-24321180, 24321302-24321485,24323094-24323264,24324002-24324125 Length = 703 Score = 28.7 bits (61), Expect = 2.6 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 85 CKFFQQGYCRYGQNCRFEH 141 C F+ QG C+ G++C F H Sbjct: 182 CTFYAQGRCKNGKSCTFLH 200 >03_02_0709 + 10583621-10583626,10583711-10584712,10585304-10585669 Length = 457 Score = 28.7 bits (61), Expect = 2.6 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 82 VCKFFQQGYCRYGQNCRFEH 141 +C +++G C YG CRF H Sbjct: 387 LCNKWERGACPYGARCRFAH 406 >01_05_0420 + 21969797-21970939,21971307-21971369,21971488-21971616, 21972241-21972291,21972669-21972809,21972922-21973122, 21973201-21973419,21973582-21973700,21973772-21973862, 21975864-21975965,21976291-21976315,21976522-21976592 Length = 784 Score = 28.7 bits (61), Expect = 2.6 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 Query: 73 IMIVCKFFQQGYCRYGQNCRFEH 141 ++ VC F+ G C+ G C+F H Sbjct: 431 VVKVCHFYLHGKCQQGNLCKFSH 453 Score = 28.7 bits (61), Expect = 2.6 Identities = 17/61 (27%), Positives = 25/61 (40%) Frame = +1 Query: 91 FFQQGYCRYGQNCRFEHVYGSKYTYHATTPQPVVTNTEHTDEQLVNQVQTDVKSVYTEAN 270 F + G C G C+F HV + +TP +N E+ Q QT + T + Sbjct: 492 FMENGMCIRGDKCKFSHVIPT--AEGPSTPDAKKSNASSVPEKANCQEQTSRQKTSTVYS 549 Query: 271 G 273 G Sbjct: 550 G 550 >07_03_1050 - 23570785-23570824,23570938-23571004,23571114-23571196, 23572028-23572201,23572268-23572471,23572570-23573300 Length = 432 Score = 28.3 bits (60), Expect = 3.5 Identities = 11/20 (55%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = +1 Query: 85 CKF-FQQGYCRYGQNCRFEH 141 C F F +GYC+ G NC+F H Sbjct: 138 CHFHFFRGYCKKGVNCQFFH 157 >01_01_1089 - 8560008-8560220,8560456-8560977,8561095-8561283, 8561377-8561642,8561967-8562111,8562411-8562530, 8562611-8562930,8564161-8564341,8564434-8564580, 8565186-8565497,8566303-8566450,8566592-8566765, 8567385-8567446,8567499-8567571,8567628-8567683, 8568370-8568645,8569541-8569588,8569870-8569991, 8570258-8570413,8571037-8571079,8572624-8572701, 8572972-8573070,8573168-8573209,8573302-8573304 Length = 1264 Score = 28.3 bits (60), Expect = 3.5 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Frame = +1 Query: 82 VCKFFQ--QGYCRYGQNCRFEHVYGS 153 +CKFF QG CR G +C F H GS Sbjct: 1012 ICKFFLTLQG-CRNGNSCSFSHDSGS 1036 Score = 27.5 bits (58), Expect = 6.1 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +1 Query: 82 VCKFFQQGYCRYGQNCRFEH 141 +C FF G C G C F H Sbjct: 985 MCVFFLNGSCNRGDTCHFSH 1004 >08_01_0395 - 3502750-3503033,3504844-3505663 Length = 367 Score = 27.9 bits (59), Expect = 4.6 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +1 Query: 64 NYPIMIVCKFFQQGYCRYGQNCRFEHVYGSKYTY 165 N+ I K+ GYC +G C F H + Y Sbjct: 245 NWKTRICNKWEMTGYCPFGSKCHFAHGAAELHKY 278 >02_05_1332 + 35758657-35758728,35758959-35760689 Length = 600 Score = 27.9 bits (59), Expect = 4.6 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +1 Query: 79 IVCKFFQQGYCRYGQNCRFEHV---YGSKYTYHAT 174 + C +FQ+G C G C F H+ GS H T Sbjct: 66 VPCYYFQKGMCVKGDRCAFLHLPQATGSPAPQHTT 100 >07_01_0281 - 2067696-2068862 Length = 388 Score = 27.5 bits (58), Expect = 6.1 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +1 Query: 100 QGYCRYGQNCRFEH 141 +G+CRYG NC++ H Sbjct: 372 KGWCRYGLNCKYCH 385 >06_03_0766 - 24425486-24426245,24430766-24430855,24430951-24431070, 24431568-24431746,24432046-24432231,24432454-24432547, 24432679-24432743,24433652-24433987 Length = 609 Score = 27.5 bits (58), Expect = 6.1 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 82 VCKFFQQGYCRYGQNCRFEH 141 +C+ F +G C +G C F H Sbjct: 578 LCENFNKGSCTFGDRCHFAH 597 >05_03_0188 + 9417186-9417306,9417418-9417604,9417669-9417801, 9418673-9418752,9421940-9422011,9422211-9422282, 9422361-9422432,9422720-9422791,9423038-9423109, 9423335-9423406,9423497-9423568,9423648-9423722, 9423824-9423895,9424072-9424137,9424223-9424299, 9424642-9425021,9425112-9425310,9425380-9425538, 9425620-9425738,9425942-9426092,9426257-9426488, 9426573-9426723,9426808-9427125 Length = 1007 Score = 27.5 bits (58), Expect = 6.1 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +3 Query: 351 LFIYESKRNNTLEQAIAYINNLTRETRQKYEQLL 452 L +YE N +L+QA+ NNL + ++E +L Sbjct: 758 LLVYEYLENGSLDQALFRDNNLNLDWAMRFEIIL 791 >09_06_0048 + 20477076-20478547,20478643-20478722,20478880-20478893, 20480164-20481199,20481275-20481402,20481673-20481732, 20481774-20481878,20481971-20482055,20482315-20482470, 20482562-20482831,20482877-20483671,20483844-20483903, 20484062-20485134 Length = 1777 Score = 27.1 bits (57), Expect = 8.1 Identities = 9/21 (42%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +1 Query: 82 VC-KFFQQGYCRYGQNCRFEH 141 VC +GYC+ G++C F H Sbjct: 1683 VCYSILDKGYCKNGEHCNFSH 1703 >02_01_0703 + 5251901-5251950,5252783-5253554 Length = 273 Score = 27.1 bits (57), Expect = 8.1 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 82 VCKFFQQGYCRYGQNCRFEH 141 +C+ F +G C +G C F H Sbjct: 243 LCENFTKGSCTFGDRCHFAH 262 >02_01_0278 - 1851338-1851412,1851579-1851819,1851946-1852047, 1852291-1852364,1852455-1852592,1852848-1853003, 1853364-1853513,1853808-1853867,1853946-1854073, 1854209-1854617,1855571-1855628,1856435-1856493, 1857478-1857606,1857765-1857774,1858134-1858183, 1858633-1858854 Length = 686 Score = 27.1 bits (57), Expect = 8.1 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 309 IIPGIHDLSPEEMRLFIYE 365 +I HDLSPE R F+Y+ Sbjct: 284 VIEANHDLSPEHHRFFLYQ 302 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,699,840 Number of Sequences: 37544 Number of extensions: 218729 Number of successful extensions: 616 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 564 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 616 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1011709100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -