BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1401 (782 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC732.02c |||fructose-2,6-bisphosphate 2-phosphatase activity ... 30 0.33 SPBC577.09 |||ERCC-8 homolog |Schizosaccharomyces pombe|chr 2|||... 29 0.99 SPAC29A4.02c |||translation elongation factor EF-1 gamma subunit... 26 5.3 SPCPB1C11.03 |||cysteine transporter |Schizosaccharomyces pombe|... 26 5.3 SPCC965.13 |||membrane transporter|Schizosaccharomyces pombe|chr... 25 9.3 >SPAC732.02c |||fructose-2,6-bisphosphate 2-phosphatase activity |Schizosaccharomyces pombe|chr 1|||Manual Length = 408 Score = 30.3 bits (65), Expect = 0.33 Identities = 13/28 (46%), Positives = 22/28 (78%) Frame = +3 Query: 90 GITLTTSTMARTMMF*KT*NLNCRKMKW 173 G+T+ TS+MART+ + +LNC+K++W Sbjct: 255 GLTVWTSSMARTIQTAR--HLNCQKLEW 280 >SPBC577.09 |||ERCC-8 homolog |Schizosaccharomyces pombe|chr 2|||Manual Length = 404 Score = 28.7 bits (61), Expect = 0.99 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 551 HSWSPIQASCFILHAYISSN 610 H+WSPI + C I AY SS+ Sbjct: 151 HAWSPIASHCLIATAYRSSS 170 >SPAC29A4.02c |||translation elongation factor EF-1 gamma subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 409 Score = 26.2 bits (55), Expect = 5.3 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -2 Query: 628 ISPVLAIATDVGMQNKTRCLNGRPAVKGSPIVR 530 +S LAIA + NKTR LNG A + + +++ Sbjct: 63 LSETLAIAFYLASLNKTRALNGTTAEEKAKVLQ 95 >SPCPB1C11.03 |||cysteine transporter |Schizosaccharomyces pombe|chr 3|||Manual Length = 570 Score = 26.2 bits (55), Expect = 5.3 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -3 Query: 363 CIFNYRSLVEVLISIGFVESIFVP 292 C +NY L+ + +GF ES +P Sbjct: 186 CAYNYGGLIALRFFLGFTESCLLP 209 >SPCC965.13 |||membrane transporter|Schizosaccharomyces pombe|chr 3|||Manual Length = 537 Score = 25.4 bits (53), Expect = 9.3 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 723 SLNLPHSVTLLEHWIWFAW 779 S+ P L +HW WF W Sbjct: 228 SIGSPIGEALYDHWRWFYW 246 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,293,250 Number of Sequences: 5004 Number of extensions: 69498 Number of successful extensions: 192 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 179 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 192 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 379359666 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -